KEGG   Gallus gallus (chicken): 422099Help
Entry
422099            CDS       T01006                                 

Gene name
ABCC3
Definition
(RefSeq) ATP binding cassette subfamily C member 3
  KO
K05667  
ATP-binding cassette, subfamily C (CFTR/MRP), member 3
Organism
gga  Gallus gallus (chicken)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    422099 (ABCC3)
Transporters [BR:gga02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    422099 (ABCC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
18
AA seq 1529 aa AA seqDB search
MEAFCGSRFWDANLSIHTDSPDLTPCFQNTILAWIPSIYLWTALPFYLLYLKRSKRGYIV
LTMLSRFKTLFGVLLWCVSWADLFYSFHELLQSRTPPPVYFVTPLVIGITVLLATLLIQY
ERLRGVQSSGVLIIFWFLSVLCAVAPFRSKIMTTTAQNHVNERFRSATFYIYFVLLIVEL
ILSCFKEKPPFFSPANTDPNPSPELTSGFLSRLTFWWFTSFAILGYKKPLEEKDLWSLNE
DDISKNIVQKLSREWDKEKAECKQKEDVTYRKKSNHALNHVGDGPEEAEVLIRDKRHNRK
PSFLKALMRTFGPYFLIGSFFKLIQDLLSFVNPQLLSVLISFVKDKDAPTWWGFLIAALM
FACAVLQTLILHQHFQYCFVTGMRLRTGIIGVIYRKSLVITNSAKRSSTVGEIVNLMSVD
AQRFMDLVTFLNMLWSAPLQTCLALYFLWQALGPSVLAGVAVMVLLIPFNSAVAIKTRAF
QVEQMRYKDSRIKLMNEILGGIKVLKLYAWEPSFSEKVLEMRKNELRVLKKSAYLNSLSN
FAWISSPFLVALTTFAVYVLVDEKNTLDAEKAFVSLSLFNILKFPLTMLPQVISNIAQTS
VSLKRIQQFLSHDELDPNCVERKVIAPGYAISVKNATFSWGKELKPSLKDINLLVPSGAL
VAVVGHVGCGKSSLVSALLGEMEKLEGEVAVKGSVAYVPQQAWIQNATLKDNILFGQAPN
EQKYQNVLEACALKTDLEVLPGGDHTEIGEKGINLSGGQRQRVSLARAVFSSSDIYLLDD
PLSAVDSHVAKHIFDQVIGPDGVLKGKTRILVTHGIGFLPQVDHIVVLADGKISEMGSYQ
ELLKQNKAFAEFLRNYALDENTEEDELTMMEEEEVLLAEDTLSIHTDLADNEPVTNEVRK
QFLRQLSVISSEGGECPNKMSTKRRVAEKKPAEPPLPRRNPNEKLIQAETTEVGTVKLTV
FWQYMKAVSPVISLIICFLYCCQNAASIGANVWLSDWTNEPVINGTQHNTSMRIGVYAAL
GLLQGFIVFVSSFTLAMGGINAARKLHTALLENKFHTPQSFYDTTPTGRIINRFSKDIFV
IDEVIPPTILMFLGTFFASLSTMIVIVASTPLFAVVVVPLAVLYYFVQRFYVATSRQLKR
LESVSRSPIYSHFSETISGTSVIRAYQRERSFIDISDLKVDENQKSYYPGIISNRWLGIR
VEFVGNCIVLFAALFAVIGKSSLNAGLVGLSVSYALQVTMALNWMVRTTSDLETNIVAVE
RIKEYSETETEAPWIIEDKRPPADWPSRGELEFVGYSVRYRKGLDLVLKDLNLRVHGGEK
IGIVGRTGAGKSSMTLCLFRILEAAKGEIRIDGVRISEIGLHDLRSRLTIIPQDPVLFSG
TLRMNLDPFNKYSDEEVWKALELSHLKRFVSSQPSMLEFECSEGGENLSVGQRQLVCLAR
ALLRKTRVLILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRILVLDN
GTIAEFDTPANLIASKGIFYGMAKDAGLV
NT seq 4590 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgttctgcggctcccgcttctgggatgcaaatctttcaatccacaccgacagt
ccagacttgacaccatgtttccagaacaccatcctggcatggatccctagtatttatctg
tggactgcattacccttttatcttctatacctgaagcgctctaaaagagggtacattgtg
ctcaccatgttgagcaggttcaagacgctgttcggtgtcctgctgtggtgtgtgagctgg
gcagatctcttctactctttccacgagctcctgcagagcagaacaccaccaccagtctat
tttgtgactccgttggtcattggcatcactgtgctgttagctacactgctgattcaatat
gaaagactgagaggggttcagtcctctggagtgctcattatcttctggtttttgtctgtg
ctctgtgccgtggcgcctttccggtctaagatcatgactacaacagcacagaaccatgta
aatgagaggttcaggtctgccacgttttacatctattttgttttgctaatcgttgagttg
atcctttcatgttttaaagaaaagcctccattcttttcccctgccaatacagaccctaat
ccctctccagagttaacttcgggctttctctcacgactgacgttctggtggtttacaagc
tttgcaattctcggttacaaaaagcctcttgaagagaaggatttgtggtcactgaatgaa
gatgatatttcaaaaaatattgtacaaaaactgagtagagaatgggacaaagaaaaagca
gagtgtaaacagaaagaagatgtgacatataggaagaaatctaaccatgcactgaatcat
gtgggggatggcccagaggaagccgaagttctgatcagggacaagaggcacaataggaag
ccttccttcctcaaagccttgatgaggacctttggaccgtacttcttaatcggctccttc
ttcaagctgatacaagacctgctttcttttgtcaaccctcagctgctaagtgtattaatc
agcttcgttaaggacaaagatgccccaacttggtggggatttttgattgcggctttgatg
tttgcctgcgctgtgctgcagaccctcatacttcaccagcatttccagtactgctttgtt
actgggatgaggttgagaactgggatcattggagtgatataccgaaagtccttggtcatc
acaaactcagcaaagcgctcatctactgttggagaaattgtcaacctgatgtcagtggat
gcccagcgcttcatggatctggtgacgttcctgaacatgttgtggtctgcaccgctccag
acctgcctggcgttgtatttcctctggcaggctctagggccatctgtgctggcaggagtc
gctgtgatggttttacttatcccattcaactccgcagtagcaatcaaaaccagagcattc
caggtggagcaaatgcggtataaagactcccgtattaagctgatgaatgagattctgggt
ggcattaaggtgctgaagctgtatgcctgggagccatccttttcagaaaaagtgttggag
atgagaaagaatgagctgcgagtgctgaaaaaatctgcctatctcaattcgttgtccaac
ttcgcgtggatcagctcaccattcctggtagcattgacaacatttgctgtctatgtctta
gtggatgagaagaataccctggatgcagaaaaggcttttgtctcgctctccttgtttaat
atcttgaagtttccactcacaatgcttccacaagtcatcagcaacattgcacagaccagt
gtttccctgaagagaattcagcagttcctgagtcacgatgagctcgatccgaattgtgtg
gagagaaaagtgattgcaccaggctatgccatcagtgtaaaaaatgcgacgttcagctgg
ggaaaggagcttaagccgtccttgaaagatataaacctgttggtccccagtggcgctttg
gttgctgttgttggccacgttggctgtgggaagtcatctctggtgtctgctctcctgggt
gagatggaaaagctggaaggagaagtggctgtgaagggttctgttgcttacgtgcctcaa
caagcttggatccagaatgccacgctgaaagataacattttgtttggccaagctcctaat
gagcaaaaataccagaatgtcctggaggcatgtgctttaaaaactgacctggaagtgcta
ccaggaggagatcacactgagataggagagaagggcatcaacctgtcaggtgggcagagg
cagcgagtgagcctcgctcgcgccgtgttcagcagctctgacatttacctgctggatgac
cctctttctgctgtggactcgcatgttgcaaagcacatcttcgaccaagttattggtcca
gatggagtgcttaaaggaaaaactcgcattctggtgacccatggcattggtttcctgccc
caggtagaccatatagttgttctagcagatggcaaaatctccgaaatgggatcttaccaa
gaacttctgaaacaaaacaaggcctttgcagaattccttcgaaattatgcacttgatgaa
aacactgaagaggatgaactaacaatgatggaagaggaggaggtcctgcttgctgaagac
accctcagcatccacactgacctggcagataatgaacccgtgacaaatgaggtccgcaaa
caatttcttaggcaacttagtgtaatatcttctgagggaggagagtgtcccaacaaaatg
tcaacgaaacgaagagtcgctgaaaagaagccagctgagcctcctctgccgagaagaaac
cctaatgagaaacttatccaggcagaaaccacagaagtgggaacggtaaagctaacggtg
ttctggcaatacatgaaggccgtcagccctgtcatctctttaattatatgtttcctatat
tgctgccaaaatgctgcttctattggggccaatgtgtggctcagtgactggaccaacgag
ccggtgataaatgggactcagcacaacacatccatgcgaattggagtctatgctgccttg
ggcctcttgcaaggcttcattgtgttcgtctcctctttcaccctggcaatgggaggcatt
aatgcagcacggaagcttcacacggctctgctggagaacaaatttcacacaccgcagtcc
ttctatgacaccacccccactgggcggatcatcaaccgcttttccaaggacatcttcgtg
atcgacgaagtcatcccccccaccatcctgatgttcctggggacgttcttcgcctccttg
tcgacaatgattgtcattgtggcaagcactccgctctttgctgtggttgtggtcccactt
gcagttctgtactactttgttcagcgattctacgtggccacatcccggcagctgaagcgc
ctggaatctgtgagcagatctcccatctactcacacttctcagaaacgatatcagggacc
agtgtcatcagagcctaccagagggagaggtccttcatagacatcagcgatctgaaggtg
gatgagaatcagaaaagttactaccctggcatcatatcaaacaggtggctgggcatccgg
gtggagtttgtggggaactgcatcgtcctttttgctgctctctttgctgtgattggtaaa
agcagcctgaatgctggcttggtgggactttcagtatcctatgcgttacaggtgaccatg
gctctgaattggatggtccgaacaacttctgatcttgaaactaacattgtggctgttgaa
agaataaaagagtattcagaaaccgaaacagaggctccctggataattgaggataagaga
cccccggcagactggccgtccagaggggagctggagttcgtgggttattcggtgcggtac
aggaagggcctcgatctggtgctgaaggatctgaacctccgggtgcacggcggggagaag
attggcattgttggccgaactggagcagggaagtcttccatgactctctgtctctttagg
atcctggaagctgcaaaaggggaaattagaattgatggtgtgagaatttcagagatcggc
ctccatgacctccgatcgaggctgacaattattcctcaggatcctgttctcttttctgga
acgctgaggatgaacctggatccatttaacaagtattcagatgaagaagtgtggaaagcc
ctcgaactgtctcatttgaagaggtttgtcagcagtcagccatccatgttggaatttgag
tgctcagaaggtggagaaaatctgagtgttggccaaaggcagctggtctgtctggcaagg
gcgctgctccgcaagacgagagtcttaatcctagatgaagcaacagcagctatcgatctg
gagacggacgatctgatccagatgacaattaggactcagtttgaagactgcacggtgctg
accatagcgcacaggctgaacaccattatggattacacaaggattctggtgctggacaac
ggaaccatcgccgaattcgatacacctgcaaaccttatagcatcaaaggggattttctac
ggtatggctaaagatgccgggctggtgtga

DBGET integrated database retrieval system