KEGG   Gallus gallus (chicken): 422188Help
Entry
422188            CDS       T01006                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
gga  Gallus gallus (chicken)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    422188 (GLA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    422188 (GLA)
   00600 Sphingolipid metabolism
    422188 (GLA)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    422188 (GLA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    422188 (GLA)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     422188 (GLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 409 aa AA seqDB search
MAAAARWALVAAVVVALAVALDNGVARTPPMGWLHWERFLCGTDCAAEPDRCVSERLFTE
MADVMVAEGWKEAGYEFVCIDDCWMAPTRDERGRLRADPRRFPSGIRALADYVHSKGLKL
GIYSDVGNTTCAGFPGSYGHYELDAQTFASWGVDLLKFDGCNADSLELLAEGYRNMSLAL
NKTGRPIVYSCEWPFYLRPMQQPNYTEIKQYCNHWRNFYDVYDSWNSIKSIMEWTALHQD
SIVKIAGPGGWNDPDMLVIGNFGLSWEQAVTQMAMWAIMAAPLFMSNDLRHMKPEAKWLL
QNKEVIAINQDPLGKQGYRITKDKNFELWERPLSDRAYAVAVLNQQEIGGPQNFTFSLTF
LGNGLACNPACCIQQILPTSRDWGVHNWVSSLSVEVNPTGTVLLKVVPL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgcgctgggccttggtggccgctgtggtggtggcattggctgtggcg
ttggataacggcgtggcgcggacgccgcccatgggctggttgcactgggagcgcttcctc
tgcggcaccgactgcgctgctgagccggaccgctgcgtcagcgagcggctgttcaccgag
atggccgacgtgatggtcgcggagggctggaaggaagcgggctacgagttcgtctgcatc
gacgactgctggatggcgcccacgcgggacgagcggggccggctgcgggcggacccccgg
cgtttccccagcggtatccgtgcactggcggactacgtccattccaaagggttaaagctg
gggatctacagcgacgtggggaacacgacgtgtgccggcttccctggcagctacgggcac
tacgagttggatgctcagacctttgcctcctggggtgtggacttgctgaagtttgatggc
tgcaacgccgactcgctggagctgctggcagaaggttacaggaacatgtctctggccctg
aacaagactggcagacctattgtgtactcctgtgaatggcctttctacctgaggcccatg
cagcagcccaattacacagagatcaaacagtattgcaatcactggaggaacttttacgat
gtctatgattcttggaacagcatcaagagtatcatggagtggacagcacttcaccaggac
agcattgtgaagatagctgggccagggggctggaatgaccctgacatgttggtgattggg
aacttcgggctgagctgggagcaggcagtgactcagatggcgatgtgggcgataatggca
gcgccgctcttcatgtccaatgacctgcggcacatgaaaccagaggccaagtggctgctc
cagaacaaggaggtgatcgccatcaaccaggatccgctgggcaagcagggctatcgcatc
actaaggacaagaacttcgagctgtgggaacggcccctatctgacagagcctatgctgtg
gcagtcctaaaccagcaggaaatcgggggaccccagaacttcaccttctccctcaccttc
ctcggcaatgggctggcctgcaacccggcgtgctgcatccagcagatcctgccgaccagc
agggactggggggttcacaactgggtctcctccctgagcgtggaagtgaacccaacaggc
actgtactgctcaaagtagtgccgctgtag

DBGET integrated database retrieval system