KEGG   Gallus gallus (chicken): 422322Help
Entry
422322            CDS       T01006                                 

Gene name
USP12P1, USP12
Definition
(RefSeq) ubiquitin specific peptidase 12 pseudogene 1
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     422322 (USP12P1)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   422322 (USP12P1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
4
AA seq 369 aa AA seqDB search
MDVLMTVRRLASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKVQPRKKESLLTCLSDLFNSIATQKKKVGVIPPKKFISRLRKENELFDNY
MQQDAHEFLNYLLNTIADLLQEEKKQEKQNGKLQNGSIESEEGDKTDLTWVHEIFQGTLT
NETRCLNCEAVSSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEQCRSKQE
AQKRMRVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYD
LVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESG
YILFYQSRD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacgtactgatgacggtccggagactcgcctccatctgtaccatgggcgccaatgcc
tcagctttggagaaagagattggtcctgaacagttccctgtgaatgagcattactttggc
ttggtcaatttcggcaatacctgctactgcaactcagtcttgcaggcactttatttttgt
cgtccatttcgggaaaaagttctggcatacaaagtgcagcctcgaaagaaggaaagcctc
ctgacatgcctctctgatctcttcaacagtattgctacccaaaagaagaaggtgggagtc
atcccacccaagaaatttatttcccgattgaggaaagaaaatgaattgtttgataattac
atgcagcaggatgcacatgaattcctaaactacctacttaacactattgctgacttgcta
caagaagagaaaaagcaggagaagcagaatggcaaactccagaatggcagcattgaaagt
gaagaaggagacaagactgatctgacgtgggtccatgaaatcttccaaggaacactaacc
aatgaaaccagatgtcttaactgtgaggctgttagtagcaaagatgaggactttctggat
ctatcggttgatgtggaacaaaatacatcaattacacactgtctgagagggtttagtaat
actgaaactctgtgcagtgaatataagtactattgtgagcagtgccgcagtaaacaggaa
gcacagaagagaatgagagtgaaaaagttgcccatgattctagctctgcacttaaaaagg
ttcaaatacatggaccagctgcatcgatacaccaaactctcctaccgtgttgtctttccc
ttggagctccggctttttaacacgtcaggagatgctacaaatcctgacagaatgtatgac
cttgtggctgtagttgttcactgtggcagtggtccaaatcgtggccattatatcaccatt
gtgaagagccatggcttttggttgctgtttgatgatgacattgtagagaaaatcgatgct
caggccattgaagagttctatgggcttacatcagacatttccaaaaactcagaatctgga
tatatcctcttctaccagtcaagagactaa

DBGET integrated database retrieval system