KEGG   Gallus gallus (chicken): 422443Help
Entry
422443            CDS       T01006                                 

Gene name
SETD7
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
FoxO signaling pathway
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gga00310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 366 aa AA seqDB search
MDSDEKKMEETVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGIYTYEDGVVLHGTYVDGELNGPAQEYDSDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEEGEMTGEKIAYVYPDGRTAYSGKFIDGEMIEAKLATLTSLEDGKP
QFEVVPGSPVYTFDKSTSSCISTNALLPDPYESERVYVDVSLISSAGEGLFSKVAAEART
VMSFYNGVRITHQEVDSRDWALNGNTISLDDETVIDVPEPYNHAAKYCASLGHKANHSFT
PNCIYDPFVHPRFGPIKCIRTIRAVEKDEELTVAYGYDHNPVGQNGPEAPEWYQLELKAF
QAAQQK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgacgaaaaaaaaatggaggagaccgtggaaggacatctagacgacgatggg
ttgccacatgggttctgtacggtcacctattcgtccacagacaggtttgagggaaacttt
gtgcatggagaaaagaatggccgtggcaagttcttcttctttgatggaagcaccctggaa
gggtactacgttgatgatgccctgcagggccagggaatctacacgtacgaggatggagtg
gtgcttcacggcacgtatgtggatggagagctgaacggcccggcccaggagtatgacagt
gatgggcgactgatattcaaagggcagtataaggacaacatccgacatggagtttgttgg
atatattacccggatggaggcagccttgtaggagaagtgaatgaagaaggagagatgact
ggagagaagatagcctatgtgtaccctgatggaaggactgcatattccggaaagttcata
gatggagaaatgatagaagcaaaactggcaaccctgacatccttagaggatgggaaacct
cagtttgaagtagtaccaggcagcccggtgtacacttttgacaaatctacttcatcctgc
atttcgacaaatgctcttcttcccgatccttatgagtcagagagggtgtatgttgatgtc
tctctcatttccagtgctggagaaggattgttttcaaaagtagcggcagaagctcgtacc
gttatgtccttttacaatggagtgagaattacacaccaggaggtagacagcagagactgg
gccctcaatgggaatacaatatccctggacgatgaaacagtcatagacgtgccggagccc
tacaaccacgccgccaagtactgtgcctcactggggcataaggccaaccattctttcact
cctaactgcatctatgacccgtttgttcaccctcggttcgggccgatcaagtgtatccgt
accatcagggctgtggagaaggacgaagaattgacagtggcctacggatacgatcacaac
cctgtggggcagaatgggccggaagcacccgagtggtaccagctggaactgaaagctttc
caggctgcccagcagaagtga

DBGET integrated database retrieval system