KEGG   Gallus gallus (chicken): 422443Help
Entry
422443            CDS       T01006                                 

Gene name
SETD7
Definition
SET domain containing (lysine methyltransferase) 7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    422443 (SETD7)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    422443 (SETD7)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     422443 (SETD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 366 aa AA seqDB search
MDSDEKKMEETVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGIYTYEDGVVLHGTYVDGELNGPAQEYDSDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEEGEMTGEKIAYVYPDGRTAYSGKFIDGEMIEAKLATLTSLEDGKP
QFEVVPGSPVYTFDKSTSSCISTNALLPDPYESERVYVDVSLISSAGEGLFSKVAAEART
VMSFYNGVRITHQEVDSRDWALNGNTISLDDETVIDVPEPYNHAAKYCASLGHKANHSFT
PNCIYDPFVHPRFGPIKCIRTIRAVEKDEELTVAYGYDHNPVGQNGPEAPEWYQLELKAF
QAAQQK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgacgaaaaaaaaatggaggagaccgtggaaggacatctagacgacgatggg
ttgccacatgggttctgtacggtcacctattcgtccacagacaggtttgagggaaacttt
gtgcatggagaaaagaatggccgtggcaagttcttcttctttgatggaagcaccctggaa
gggtactacgttgatgatgccctgcagggccagggaatctacacgtacgaggatggagtg
gtgcttcacggcacgtatgtggatggagagctgaacggcccggcccaggagtatgacagt
gatgggcgactgatattcaaagggcagtataaggacaacatccgacatggagtttgttgg
atatattacccggatggaggcagccttgtaggagaagtgaatgaagaaggagagatgact
ggagagaagatagcctatgtgtaccctgatggaaggactgcatattccggaaagttcata
gatggagaaatgatagaagcaaaactggcaaccctgacatccttagaggatgggaaacct
cagtttgaagtagtaccaggcagcccggtgtacacttttgacaaatctacttcatcctgc
atttcgacaaatgctcttcttcccgatccttatgagtcagagagggtgtatgttgatgtc
tctctcatttccagtgctggagaaggattgttttcaaaagtagcggcagaagctcgtacc
gttatgtccttttacaatggagtgagaattacacaccaggaggtagacagcagagactgg
gccctcaatgggaatacaatatccctggacgatgaaacagtcatagacgtgccggagccc
tacaaccacgccgccaagtactgtgcctcactggggcataaggccaaccattctttcact
cctaactgcatctatgacccgtttgttcaccctcggttcgggccgatcaagtgtatccgt
accatcagggctgtggagaaggacgaagaattgacagtggcctacggatacgatcacaac
cctgtggggcagaatgggccggaagcacccgagtggtaccagctggaactgaaagctttc
caggctgcccagcagaagtga

DBGET integrated database retrieval system