KEGG   Gallus gallus (chicken): 422455Help
Entry
422455            CDS       T01006                                 

Gene name
USP38
Definition
(RefSeq) ubiquitin specific peptidase 38
  KO
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     422455 (USP38)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   422455 (USP38)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    422455 (USP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
4
AA seq 787 aa AA seqDB search
MITVLIMSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVETWVIALLKGLAAVQKFTILI
DVTLMKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLVVPHVVSLVHSFKSDGL
PSSTAFLMQLAELIHCMMYHYSGFPELYEPILEVFKDMPKPSEEKMRLILSQSAWTSQSN
SLPSCLSRLSGKSETGKTGLINLGNTCYMNSIIQALFMATDFRRHVLSLNLNGCNSLMRK
LQHLFAFLAHTQREAYAPRIFLEASRPPWFTPQSQQDCSEYLRFLLNRLHEEERTLKALS
SAKAAESRKNEESQAQETVHKAQVFAEALCKGSEERTLIERMFGGKLKTTICCLNCKSTS
QKEEAFTDLSLAFCPPTSLESAGVKCLEHSEIKDGSVVQSSISATPAGETPPSSLEINGG
CNAITNEGILKDSAEPNSEPKSEFNKDQDSRDVSSALVGKNTPSVTDLLNYFLAPEILSG
DNKYYCEKCASLQNAEKTMQIIEEPEYLILTLLRFSYDPKCHIRRKILDSVSLPLLLELP
VRRATSPLAVVSGSWSVDVEISDIGENLAKKLKPSGADEVSCPQLVPYVLSSVVVHSGVS
SESGHYYSYARNVTGSGSSGQCHQSKAFSLISTQNKLLAEEGPCTVIENELDTEMPKEWF
LFNDSRVTFTSFQSVQKITSRFPKDTAYVLIYKKQNSTCGYNTNSANGLWVNGDPPLQKD
LMDAITKDNKLYLQEQELSARTQALQAASASCSFRPNGFDDNDPPGSCGPAGGGGGGGFS
TVGRLVF
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgattacagtactcatcatgagccttactacagacccaaatgtgaaagatgcgagtatg
actcaagcgctgtgcagaatgattgactggttgtcttggcctttggctcagcatgtggaa
acgtgggtgattgcactgctgaaaggactagctgcagtccagaaatttactatccttatt
gatgtcactctgatgaagattgaactggtctttaatcgactttggtttcctttagtaaga
cctggtgcccttgctgttctttctcatatgttacttagtttccagcattctccagaagct
tttcatttggttgtcccacatgtggtcagcttggttcactccttcaaaagtgatggctta
ccttccagtacagcgtttttgatgcagttggctgagttgatacattgtatgatgtatcat
tattcaggttttccagagctctatgaacccattctggaagtttttaaggatatgcccaag
cccagcgaagaaaaaatgaggctgattctcagtcagagtgcctggacttctcaatccaat
tctttgccatcttgtttatctagactttctggaaaatctgaaactgggaagactggcttg
attaacctaggaaatacctgctacatgaacagcattattcaggcacttttcatggctact
gatttcagaagacatgttttatctctgaatctaaatggttgtaattcattgatgaggaaa
ttacagcatctttttgcatttttggcccatacccagagggaggcatatgctcctagaatt
ttccttgaggcttccagaccaccatggttcacccctcaatcgcagcaggattgctcagaa
tatctccggttcctgctcaacaggcttcacgaagaagagagaactttgaaagcattgtct
tcagcaaaggctgctgaaagtaggaagaatgaagagtcccaggcacaagaaactgtccat
aaagcacaggtatttgccgaagcactttgtaaggggagtgaagaaagaactctcatagag
agaatgtttggaggaaaactgaagactactatatgctgtttgaactgcaaaagcacatct
caaaaggaggaagcttttacagatctctctttggctttctgtcctccgacatccttggaa
agcgctggtgtgaaatgtctggaacattctgaaataaaagatggctctgtggtgcaaagt
agtatttcagcaactcctgctggagaaacacctcccagtagtttggaaataaatggcgga
tgcaacgcaattacaaatgaaggaatcctaaaggattctgctgagccaaactctgagcca
aaatctgaatttaacaaggatcaagatagtagggatgtttcttctgcgctagtggggaaa
aacaccccatcagtaacggacttattgaattattttctggcacctgagatccttagtgga
gacaataagtattattgtgaaaagtgtgcctctctacaaaatgctgagaaaactatgcaa
atcattgaggaacctgaatacctcattctcactcttctgagattttcatatgatccaaag
tgtcatataagacgtaaaatcttggacagcgtttctctgccacttcttttggaactgcca
gtcagaagagcaacgtcccctctagctgtggtttcaggaagttggtctgttgacgttgag
atttctgatattggagaaaatcttgctaaaaagctgaagccctcaggtgctgatgaagta
tcttgcccacagctggtgccctatgtgctaagttctgtagtggtgcactctggtgtatcc
tctgaaagtggacattactattcatatgctagaaatgttactggttcaggttcttcagga
cagtgtcaccaatctaaagctttttctttaatttctactcagaataagttgttagcagag
gagggtccttgtactgttatagaaaatgagttggacactgagatgccaaaagaatggttt
ttattcaatgacagcagagtgacatttacctcatttcagtcagtccagaaaattaccagt
aggtttccaaaggacactgcttatgttctgatttacaaaaagcaaaatagtacctgtggc
tacaacacaaattcagcaaatggactctgggtgaatggagaccctcccctacaaaaagac
ctcatggatgcaattacaaaagataacaaactatacttgcaggagcaagagcttagtgct
cgaacacaagcacttcaagctgcctcagcctcgtgttctttccgccccaatggatttgat
gacaatgatcccccgggaagttgtggaccagcaggtggaggaggagggggtggattcagt
actgttggtagattagtcttttga

DBGET integrated database retrieval system