KEGG   Gallus gallus (chicken): 422592Help
Entry
422592            CDS       T01006                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04137  Mitophagy - animal
gga04140  Autophagy - animal
gga04141  Protein processing in endoplasmic reticulum
gga04210  Apoptosis
gga04217  Necroptosis
gga04310  Wnt signaling pathway
gga04510  Focal adhesion
gga04530  Tight junction
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04920  Adipocytokine signaling pathway
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05132  Salmonella infection
gga05164  Influenza A
gga05168  Herpes simplex infection
Module
gga_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    422592 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    422592 (MAPK10)
   04012 ErbB signaling pathway
    422592 (MAPK10)
   04310 Wnt signaling pathway
    422592 (MAPK10)
   04068 FoxO signaling pathway
    422592 (MAPK10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    422592 (MAPK10)
   04137 Mitophagy - animal
    422592 (MAPK10)
  Cell growth and death
   04210 Apoptosis
    422592 (MAPK10)
   04217 Necroptosis
    422592 (MAPK10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    422592 (MAPK10)
   04530 Tight junction
    422592 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    422592 (MAPK10)
   04621 NOD-like receptor signaling pathway
    422592 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    422592 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    422592 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    422592 (MAPK10)
   04920 Adipocytokine signaling pathway
    422592 (MAPK10)
   04912 GnRH signaling pathway
    422592 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    422592 (MAPK10)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    422592 (MAPK10)
  Infectious diseases
   05132 Salmonella infection
    422592 (MAPK10)
   05164 Influenza A
    422592 (MAPK10)
   05168 Herpes simplex infection
    422592 (MAPK10)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     422592 (MAPK10)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   422592 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 422592
NCBI-ProteinID: NP_001305153
CGNC: 8434
Ensembl: ENSGALG00000011109
UniProt: A0A1D5PXC6
Position
4
AA seq 464 aa AA seqDB search
MSRHLLYYCGEPTLDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAILDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSANDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccatttgttgtactattgtggtgaacctaccctggatgtgaagattgccttt
tgtcagggatttgggaaacaagtggatgtgtcatacattgccaagcattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtgggtgactcgaccttcactgtt
ctcaagcgctaccagaacttgaaaccaattggctctggggctcagggaatagtttgtgct
gcatacgatgccatccttgatagaaacgtggccattaagaagctcagcagaccattccag
aaccaaacccatgccaagcgtgcttacagagagctggtcctcatgaagtgtgtgaatcac
aaaaatattatcagtttattaaatgtcttcacaccacagaaatctctggaggagttccag
gatgtttacctggtgatggagctgatggatgccaacctgtgccaggtgattcagatggag
ctagaccatgaacgaatgtcctacctgctgtaccaaatgctctgcggcatcaaacacctg
cactctgcgggaattattcacagggatttaaaaccaagtaacattgtggtaaaatctgac
tgcacgctgaagatattggattttgggctggccaggactgcgggcaccagcttcatgatg
actccgtacgtggtgacacggtactacagagcaccggaggtcatcctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggattatattgaccagtggaataaagtcatagagcagttggga
acaccctgcccagagttcatgaagaagctgcagccaacggtgcggaactacgtggagaac
cggcctaagtacgctggcctcaccttccccaaactgtttcctgattctctcttcccagct
gactcagaacacaacaaactcaaagccagccaagctcgggacctgctgtccaaaatgctg
gtcatcgatccagccaagcgcatatcggtggacgaggccctgcagcacccatacatcaac
gtctggtacgaccctgccgaggtggaggcgccacccccccagatctatgacaagcagctg
gacgagcgggagcacaccattgaggagtggaaagaactcatctacaaagaagtaatgaat
tctgaagaaaagacgaaaaatggcgtagtaaaaggacagccatctccttcaggtgcagca
gtgaacagcagcgagagcctccccccatcctcatcggccaacgacatctcctccatgtcc
acggatcagacgctggcgtccgacacggacagcagcctggaagcatcggcggggccactg
gggtgctgcaggtga

DBGET integrated database retrieval system