KEGG   Gallus gallus (chicken): 422592Help
Entry
422592            CDS       T01006                                 

Gene name
MAPK10
Definition
mitogen-activated protein kinase 10
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gga04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:gga04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:gga04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:gga04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:gga04622]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:gga04920]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:gga04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:gga04914]
Human Diseases; Infectious diseases; Salmonella infection [PATH:gga05132]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:gga05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
4
AA seq 480 aa AA seqDB search
MSRHLLYYCGEPTLDVKIAFCQLGFLSSFPTPFPSAQQGFGKQVDVSYIAKHYNMSKSKV
DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILDRNVAIKKLSRPFQNQTH
AKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHE
RMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYV
VTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCP
EFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDP
AKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEK
TKNGVVKGQPSPSGAAVNSSESLPPSSSANDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccatttgttgtactattgtggtgaacctaccctggatgtgaagattgccttt
tgtcagcttgggtttctgtcttccttcccaacccccttcccttctgcacaacagggattt
gggaaacaagtggatgtgtcatacattgccaagcattacaacatgagcaaaagcaaagtt
gacaaccagttctacagcgtggaagtgggtgactcgaccttcactgttctcaagcgctac
cagaacttgaaaccaattggctctggggctcagggaatagtttgtgctgcatacgatgcc
atccttgatagaaacgtggccattaagaagctcagcagaccattccagaaccaaacccat
gccaagcgtgcttacagagagctggtcctcatgaagtgtgtgaatcacaaaaatattatc
agtttattaaatgtcttcacaccacagaaatctctggaggagttccaggatgtttacctg
gtgatggagctgatggatgccaacctgtgccaggtgattcagatggagctagaccatgaa
cgaatgtcctacctgctgtaccaaatgctctgcggcatcaaacacctgcactctgcggga
attattcacagggatttaaaaccaagtaacattgtggtaaaatctgactgcacgctgaag
atattggattttgggctggccaggactgcgggcaccagcttcatgatgactccgtacgtg
gtgacacggtactacagagcaccggaggtcatcctgggaatgggctacaaggagaacgtg
gatatatggtctgtgggatgcattatgggagaaatggttcgccacaaaatcctctttcca
ggaagggattatattgaccagtggaataaagtcatagagcagttgggaacaccctgccca
gagttcatgaagaagctgcagccaacggtgcggaactacgtggagaaccggcctaagtac
gctggcctcaccttccccaaactgtttcctgattctctcttcccagctgactcagaacac
aacaaactcaaagccagccaagctcgggacctgctgtccaaaatgctggtcatcgatcca
gccaagcgcatatcggtggacgaggccctgcagcacccatacatcaacgtctggtacgac
cctgccgaggtggaggcgccacccccccagatctatgacaagcagctggacgagcgggag
cacaccattgaggagtggaaagaactcatctacaaagaagtaatgaattctgaagaaaag
acgaaaaatggcgtagtaaaaggacagccatctccttcaggtgcagcagtgaacagcagc
gagagcctccccccatcctcatcggccaacgacatctcctccatgtccacggatcagacg
ctggcgtccgacacggacagcagcctggaagcatcggcggggccactggggtgctgcagg
tga

DBGET integrated database retrieval system