KEGG   Gallus gallus (chicken): 422598Help
Entry
422598            CDS       T01006                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    422598 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    422598 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    422598 (SCD5)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     422598 (SCD5)
Lipid biosynthesis proteins [BR:gga01004]
 Desaturase
  First
   422598 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
4
AA seq 247 aa AA seqDB search
MTALGVTAGAHRLWSHRSYKAKLPLRIFLAVANSMAFQNDIYEWSRDHRVHHKYSETDAD
PHNARRGFFFSHIGWLFVRKHKDVIEKGRKLDFTDLLDDPVVRFQRKYYKSSVVLMCFVI
PTVVPWYLWGESLWNAYFLASILRYTISLNVTWLVNSAAHMYGNRPYDKNINPRQNTFVT
LGAIGEGFHNYHHTFPFDYSASELGLKFNPTTWFIDFMFWLGLVTERKQAPKEMIQARKE
RTGDGSA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacagccttgggcgtgacggctggtgcgcatcgcttgtggagccaccgttcgtacaaa
gccaagctgcctctgcgaatcttcctggctgtagctaactccatggccttccagaatgac
atctacgagtggagccgagaccaccgcgtgcaccacaagtactcggagacagatgcggac
ccacacaatgcccgccggggcttcttcttctcccacattggctggctgtttgtgcgcaag
cacaaagacgtcatagaaaagggaagaaagctggatttcaccgatctgctggatgacccc
gtcgtcagattccaaagaaagtactacaagagttcagtcgtgctgatgtgctttgtgatc
cccaccgttgtgccatggtacctctggggagagagtctgtggaatgcctacttcctcgcc
tccatcctccggtacaccatctccctcaacgtcacctggctggtcaacagcgccgctcac
atgtatggcaaccgcccttatgacaagaacatcaaccccaggcagaacacctttgtcact
ctgggagccatcggtgagggtttccacaattaccaccacaccttccccttcgactactca
gccagcgagctgggcctgaagttcaaccccaccacctggttcattgacttcatgttttgg
ttggggttggtcactgagaggaaacaggctcccaaggagatgatccaggcacgcaaggaa
aggactggagatggcagtgcttga

DBGET integrated database retrieval system