KEGG   Gallus gallus (chicken): 422660Help
Entry
422660            CDS       T01006                                 

Gene name
UGT2A3, UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A3
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    422660 (UGT2A3)
   00053 Ascorbate and aldarate metabolism
    422660 (UGT2A3)
   00500 Starch and sucrose metabolism
    422660 (UGT2A3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    422660 (UGT2A3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    422660 (UGT2A3)
   00860 Porphyrin and chlorophyll metabolism
    422660 (UGT2A3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    422660 (UGT2A3)
   00982 Drug metabolism - cytochrome P450
    422660 (UGT2A3)
   00983 Drug metabolism - other enzymes
    422660 (UGT2A3)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     422660 (UGT2A3)
Glycosyltransferases [BR:gga01003]
 Others
  Hydrophobic molecule
   422660 (UGT2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
4
AA seq 553 aa AA seqDB search
MQAQPISVCSAAPKEARPLRLREALQIMSGKKVAVLWLLAALGSVYGGKVLVWPVDNSHW
LNVEYILHELVARGHEVTVLLPSCFLILNGTQPSPFQFEMIEVPISKSEMAAAMDEGFYF
WFYEERRLPFWESLYKMIDLLRKFENITRTICDAVLKDKVLLERLRTSAFDVLLADPLMP
SGELFAEKLGIPLVYTIRFSMGNTVERLCGGLPAPPSYVPASLSSLTDKMTFTERLKNMF
SYALQDLAYHYVLWGHWNQFYSDILGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFE
FVGGLHCQPAKPLPKEIEEFVQSSGEHGIVVFSLGSMVYNLTSERSNVIARALSQLPQNV
LWRYKGKKPEALGSNTRIYDWIPQNDLLGHPLAKAFITHGGTNGIYEAIYHGIPMVGIPM
FADQHDNVAHMRAKGAAVELDFSTLTTQNLVDAVNTVINNSTYKESVLKLSKIHHDQPIK
PLDRAVFWIEFVMRHKGAKHLRPAAHHLTWYQYHCLDVLAFLFICAAIAGFILVKCCMFC
CRKCGRVTKKKKE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcccagcccatctcggtgtgctctgctgctcccaaggaagcaaggccactgagg
ctccgagaagcactgcaaatcatgtcaggaaagaaggtggctgtgctgtggctgctggct
gcactgggctccgtgtatggtgggaaggtgttggtctggccagttgacaacagccactgg
ctcaacgtggagtatatcctgcacgaacttgtagcccggggccatgaggtgactgtgctg
ctgccttcgtgcttccttatcctcaatggcacccagccctcacctttccagtttgagatg
attgaggtgccaatcagcaaaagtgagatggctgccgcaatggatgaaggtttctatttt
tggttctatgaggagagaaggttacctttctgggaaagtctttacaagatgattgatctg
ctacgcaagtttgagaatataaccagaaccatttgcgatgcagttttgaaggacaaggtg
ctgctggaaaggctgaggacatctgcctttgatgtcctcctggcagacccactgatgccc
agcggggagctgtttgcagagaagctgggtatccctttggtgtacaccatccggttctcc
atgggcaacactgtggagcggctctgcggggggctcccagcacctccttcctacgtgcca
gccagcctaagctccctaacagacaagatgaccttcacagagaggctaaaaaacatgttc
tcctatgctctgcaggacctcgcataccattacgttctctggggacattggaatcaattc
tacagtgatattttaggaaggcccacaacactgtgtgagacgatgggaaaagcagagata
tggctaatcagaacatactgggattttgaatttcctcgccctttcctgcccaactttgag
tttgttggaggacttcactgccagcctgcaaagccactgccaaaggaaatcgaagaattt
gttcagagttcaggggaacatggcattgtggtattttctctcgggtcaatggtctacaac
ctaaccagtgaaagaagtaatgtgattgccagagccctcagccagcttccacaaaatgtc
ctctggcgatacaaaggtaaaaaaccagaagctcttggctccaacaccaggatttatgac
tggataccccaaaatgacctgcttggccatcccttggcaaaggccttcattactcatggt
gggaccaatgggatctatgaagctatttaccatggaatcccaatggttgggattcccatg
tttgctgaccagcatgacaacgttgctcacatgagggcaaaaggagctgcagttgagctg
gatttcagcacactgacgacacagaatctagttgatgcagtgaatacagtcattaacaat
tctacctacaaggaaagtgttttaaagttatccaagatacaccacgaccagccaattaag
cctctggacagagctgtcttctggattgaatttgtcatgcgtcacaaaggagcaaagcac
ttgagaccagctgctcaccatcttacctggtaccagtaccactgcctggatgttctggca
ttcttgttcatctgtgcagccattgctggcttcattcttgtcaagtgctgcatgttttgc
tgtagaaaatgtggtagggtcacaaagaaaaagaaagaatag

DBGET integrated database retrieval system