KEGG   Gallus gallus (chicken): 422660Help
Entry
422660            CDS       T01006                                 

Gene name
UGT2A1, UGT2A3
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00040  Pentose and glucuronate interconversions
gga00053  Ascorbate and aldarate metabolism
gga00140  Steroid hormone biosynthesis
gga00830  Retinol metabolism
gga00860  Porphyrin and chlorophyll metabolism
gga00980  Metabolism of xenobiotics by cytochrome P450
gga00982  Drug metabolism - cytochrome P450
gga00983  Drug metabolism - other enzymes
gga01100  Metabolic pathways
Module
gga_M00014  Glucuronate pathway (uronate pathway)
gga_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    422660 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    422660 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    422660 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    422660 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    422660 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    422660 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    422660 (UGT2A1)
   00983 Drug metabolism - other enzymes
    422660 (UGT2A1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     422660 (UGT2A1)
Glycosyltransferases [BR:gga01003]
 Others
  Hydrophobic molecule
   422660 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 422660
NCBI-ProteinID: XP_004941250
CGNC: 51797
Ensembl: ENSGALG00000011805
UniProt: F1NMB3
Position
4
AA seq 529 aa AA seqDB search
MTGQRFSWLLWTFACCWNVGFCGKVVVWPTDASHWINMKVLLEELILRGHEVTVLVPSIN
MLIDYQDTSSPFTFEVLKVNFTQETFDALMVDFLDLWINDLPNLFPWEVMWRMKEAIYSF
SNLSKHSCDALVSNHQLIAKLHQAKFDVLIADPLAVCGELAAQLLEIPFVYSFRFSEGNV
VERLCGGLPSPPSYVPASTTGLTDQMSFVERLWNFFFYLSMDLFFLKFWRDEWDGYYSNV
LGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLPKEIEEFVQSS
GEHGIVVFSLGSMVYNLTSERSNVIARALSQLPQNVLWRYKGKKPEALGSNTRIYDWIPQ
NDLLGHPLAKAFITHGGTNGIYEAIYHGIPMVGIPMFADQHDNVAHMRAKGAAVELDFST
LTTQNLVDAVNTVINNSTYKESVLKLSKIHHDQPIKPLDRAVFWIEFVMRHKGAKHLRPA
AHHLTWYQYHCLDVLAFLFICAAIAGFILVKCCMFCCRKCGRVTKKKKE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacggggcaaagattctcctggctactctggacctttgcgtgctgctggaatgttggc
ttttgtgggaaggtggtggtctggcccaccgatgccagtcactggatcaacatgaaagtg
ctgctggaagaactcattctccggggtcacgaagtgactgtgctggtaccatcaataaat
atgctcattgactaccaagacacatcatctcctttcacctttgaggtcctgaaagtgaac
ttcacccaagagaccttcgatgctctgatggtggacttcttagatctctggattaatgac
ctccctaatctgttcccctgggaggtcatgtggaggatgaaagaagccatatactccttt
tccaacttgtcaaagcactcctgtgatgccttggtgtcaaatcatcagctgatagcaaag
ctgcatcaggccaagtttgatgttctgatcgctgaccctttagctgtatgtggtgagctt
gcagcacaactcctggaaattccttttgtctacagcttccgtttttctgagggaaatgtg
gtagagcggctgtgtggtgggctcccatctccaccttcttacgtgcctgctagcacaaca
gggttgacagaccagatgtcctttgtggagagactgtggaatttcttcttttacctttcc
atggatttatttttcttaaagttttggcgagatgaatgggatggatactacagtaatgtc
ttgggaaggcccacaacactgtgtgagacgatgggaaaagcagagatatggctaatcaga
acatactgggattttgaatttcctcgccctttcctgcccaactttgagtttgttggagga
cttcactgccagcctgcaaagccactgccaaaggaaatcgaagaatttgttcagagttca
ggggaacatggcattgtggtattttctctcgggtcaatggtctacaacctaaccagtgaa
agaagtaatgtgattgccagagccctcagccagcttccacaaaatgtcctctggcgatac
aaaggtaaaaaaccagaagctcttggctccaacaccaggatttatgactggataccccaa
aatgacctgcttggccatcccttggcaaaggccttcattactcatggtgggaccaatggg
atctatgaagctatttaccatggaatcccaatggttgggattcccatgtttgctgaccag
catgacaacgttgctcacatgagggcaaaaggagctgcagttgagctggatttcagcaca
ctgacgacacagaatctagttgatgcagtgaatacagtcattaacaattctacctacaag
gaaagtgttttaaagttatccaagatacaccacgaccagccaattaagcctctggacaga
gctgtcttctggattgaatttgtcatgcgtcacaaaggagcaaagcacttgagaccagct
gctcaccatcttacctggtaccagtaccactgcctggatgttctggcattcttgttcatc
tgtgcagccattgctggcttcattcttgtcaagtgctgcatgttttgctgtagaaaatgt
ggtagggtcacaaagaaaaagaaagaatag

DBGET integrated database retrieval system