KEGG   Gallus gallus (chicken): 422703Help
Entry
422703            CDS       T01006                                 

Gene name
EIF4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:gga03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:gga04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
4
AA seq 233 aa AA seqDB search
MEKLTCEWDKIRNLLVNPFFKQETTPNPQPSEEEKTEPAPTQEVASPEQYIKHPLQNRWA
LWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWED
EKNKRGGRWLITLTKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRTKGDKIA
IWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagaaactaacatgcgagtgggataagataaggaacttattagtgaatcctttcttc
aaacaggaaaccactcccaaccctcaaccttcagaagaggagaaaaccgagccagcgcct
actcaggaggttgccagccctgaacagtatattaagcatccactacaaaacagatgggcg
ctctggttttttaaaaatgacaagagcaaaacttggcaagcaaatcttcgtctgatttcc
aagtttgatactgttgaagatttttgggctttatacaaccatatccagctctctagtaat
ttaatgcctggttgtgactactcgctgtttaaggatgggattgaacccatgtgggaagat
gagaaaaacaagcgaggaggccgatggctaattacactaaccaaacagcagagacgaagt
gaccttgatcgcttctggctagagacactgctgtgccttattggggagtcatttgatgac
tacagcgatgatgtatgtggtgctgttgttaatgttagaactaaaggtgataaaatagca
atatggacaactgaatgtgaaaacagggatgctgttacgcatatagggagagtatacaag
gaaagattaggacttcctccaaagatagtgattggttatcagtcccatgcagacacagct
actaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system