KEGG   Gallus gallus (chicken): 422703Help
Entry
422703            CDS       T01006                                 

Gene name
EIF4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    422703 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    422703 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    422703 (EIF4E)
Translation factors [BR:gga03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    422703 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
4
AA seq 233 aa AA seqDB search
MEKLTCEWDKIRNLLVNPFFKQETTPNPQPSEEEKTEPAPTQEVASPEQYIKHPLQNRWA
LWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWED
EKNKRGGRWLITLTKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRTKGDKIA
IWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagaaactaacatgcgagtgggataagataaggaacttattagtgaatcctttcttc
aaacaggaaaccactcccaaccctcaaccttcagaagaggagaaaaccgagccagcgcct
actcaggaggttgccagccctgaacagtatattaagcatccactacaaaacagatgggcg
ctctggttttttaaaaatgacaagagcaaaacttggcaagcaaatcttcgtctgatttcc
aagtttgatactgttgaagatttttgggctttatacaaccatatccagctctctagtaat
ttaatgcctggttgtgactactcgctgtttaaggatgggattgaacccatgtgggaagat
gagaaaaacaagcgaggaggccgatggctaattacactaaccaaacagcagagacgaagt
gaccttgatcgcttctggctagagacactgctgtgccttattggggagtcatttgatgac
tacagcgatgatgtatgtggtgctgttgttaatgttagaactaaaggtgataaaatagca
atatggacaactgaatgtgaaaacagggatgctgttacgcatatagggagagtatacaag
gaaagattaggacttcctccaaagatagtgattggttatcagtcccatgcagacacagct
actaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system