KEGG   Gallus gallus (chicken): 422715Help
Entry
422715            CDS       T01006                                 

Gene name
BDH2, DHRS6
Definition
3-hydroxybutyrate dehydrogenase, type 2
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gga  Gallus gallus (chicken)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gga00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:gga00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 269 aa AA seqDB search
MGRLDGKVILLSAAAQGIGRATAIAFAKEGAKVIATDINKTKLQELEIYPGIQVRVLDVT
KREQIEELAKEIERIDVLCNIAGFVHHGTILDCEEEDWNFAMNLNVRSMYLMIKTFLPKM
IKQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFIEQGIRCNCVCPGTV
DTPSLQQRIKAQPNPDQVSVIQNLGRKFLNSNRVLESSTPLFLTMCTRRLDKTSALPEFK
FYVQTVKTYVCDTFPYLFFFFFQELINTC
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggggcggcttgatgggaaagtaatacttctgtctgctgcagcacaagggattggacga
gccactgctatcgcttttgctaaagaaggagccaaagtcattgctacagacatcaataag
actaagctgcaagaactggagatttatccaggcattcaagtacgggttctggatgtcacc
aaaagggaacagatagaagagctggcaaaggagattgaaaggatagatgtcctctgtaat
attgcagggtttgttcatcatgggaccattctggattgtgaggaagaagactggaacttt
gctatgaacctcaacgttcgcagcatgtatctaatgatcaagacattccttcctaagatg
atcaaacagaaatctggaaatattataaacatgtcttctgtggcatccagcattaaagga
gttgtgaacagatgtgtatatagtacttccaaggcagcagttattggtctcacaaagtct
gtggctgctgatttcattgaacaagggatcagatgcaactgtgtatgtcccggaactgtt
gacacaccatctttacagcagagaatcaaagcccagcctaacccagaccaggtgagtgtt
atccaaaacttgggaagaaaattcttgaactctaacagggtgttagaaagcagcactcct
ttattcctcacgatgtgtaccaggagacttgacaaaacaagtgcactgccagagttcaag
ttctacgttcaaacagttaagacatatgtatgcgatacatttccatacctattctttttt
tttttccaagaactcattaatacatgttag

DBGET integrated database retrieval system