KEGG   Gallus gallus (chicken): 422750Help
Entry
422750            CDS       T01006                                 

Gene name
SRD5A3
Definition
steroid 5 alpha-reductase 3
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    422750 (SRD5A3)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     422750 (SRD5A3)
    1.3.1.94  polyprenol reductase
     422750 (SRD5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
4
AA seq 310 aa AA seqDB search
MPAVLGAAWALLAAAFLLLLLLHRAQARRPGGGTDVASAFFQDLIRYGKTKRGGQQAAWL
HRLQVPKRWFTHFYVVSILWNGFLLIRLFQAQFLGASLPPWIQIFHSAFGRDLQDQNTDS
ESFSALLVLLLLWLHSFQRLAECLYTSVFSNGVIHIVQYCFGLGYYVAVGSTVLCQVPTN
VRNGKGLSVHIFWYHIIGVAMYFWASLHQHRCLVILANLRKSKSGEVLSLHHSIPFGDWF
ERVSCPHYFAELLIYISMAITFGFHNVTWWFVVLYVFFNQTLAAVLCHEFYQEKFTSYPK
HRKAFIPFIL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgctgggcgctgcctgggccctgctggccgccgccttcctactgctgctg
ctgctacaccgggcccaggcgaggcggcccggtggaggcaccgacgtcgcctccgcattt
ttccaggatctcatccgctacgggaagaccaagagaggcgggcagcaggctgcctggctg
caccgcttgcaggtgcccaagaggtggtttactcatttttacgtagtttctatactctgg
aatggctttctgctgattaggctttttcaagctcagttccttggagcatcactccctcca
tggattcagatcttccatagtgcttttggcagagatttgcaggaccagaatacggatagc
gaaagcttctctgcactcttggttctcctgctcctttggctgcatagctttcaaagactt
gcagaatgcctctataccagcgtgttttccaatggcgtcatccacattgtgcagtattgc
tttggacttggctattacgttgctgttggctcaactgtgctatgtcaagtacctactaat
gttaggaatggaaaaggactttctgtgcacatcttctggtatcacatcataggcgttgcg
atgtacttttgggcctctcttcaccagcacagatgtcttgtgattctagctaatcttaga
aaaagcaaatcaggagaggttttaagtctgcaccacagtataccttttggggactggttt
gaaagagtttcttgccctcattattttgcagaactcctcatctatatatccatggccatc
acatttggatttcacaacgtgacgtggtggtttgtggtgctgtatgtcttttttaaccag
acgctggctgctgttttgtgtcatgagttctatcaggaaaaatttacctcctacccaaag
catcgaaaagcattcataccatttattctttag

DBGET integrated database retrieval system