KEGG   Gallus gallus (chicken): 422758Help
Entry
422758            CDS       T01006                                 

Gene name
USP46
Definition
ubiquitin specific peptidase 46
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     422758 (USP46)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   422758 (USP46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 381 aa AA seqDB search
MWCPSMPCAGNATHTIQLPWRTEPASGGTNASALEKDIGPEQFPINEHYFGLVNFGNTCY
CNSVLQALYFCRPFRENVLSYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISR
LRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEAEENNKQEL
TWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQ
KYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNT
SGDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYG
LTSDISKNSESGYILFYQSRE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgccccagcatgccttgtgctggcaatgccacacataccattcagctgccctgg
agaacggagcctgcctccgggggcaccaatgcctctgctctggaaaaagacattggccca
gagcagtttcccatcaatgaacactacttcggattggtcaattttgggaacacctgctac
tgtaactccgtgctgcaggcattgtacttttgccggccatttcgggaaaatgtgttatca
tacaaggcccaacagaaaaagaaggaaaatctcttgacttgcctggcagatcttttccac
agtattgctactcagaagaagaaagtcggagttattccaccaaagaagttcatatcaagg
ttacgaaaagagaatgatctctttgacaactacatgcagcaggatgcacatgagttttta
aattacttgctgaatacaatcgccgacattttgcaggaggagaagaaacaggaaaagcaa
aatgggaaactgaaaaatggcaacatgaacgaagctgaagagaacaataagcaagaactc
acctgggtgcatgagatttttcagggaacactgactaacgaaactagatgtttgaactgt
gaaactgttagtagcaaagatgaagattttcttgacctttctgttgatgtggagcagaac
acatcaattacacactgtctaagagacttcagtaacacagagacattatgtagtgagcag
aaatactactgtgaaacctgctgcagtaagcaagaggcacagaaaaggatgcgagtaaaa
aagctaccaatgattcttgccttacacctcaagagattcaagtacatggagcaattgcac
aggtatactaagctgtcttatcgtgtagtatttcccctggaattacgtctcttcaatacg
tctggtgatgctgtcaacttagaccggatgtacgacttagtagctgttgttgttcactgt
ggaagtggaccgaatcgtgggcattatattactattgtgaaaagtcatggattttggctc
ttgtttgatgatgacattgtagagaaaatagatgctcaagctattgaagaattttatgga
ctgacctctgatatatcaaaaaattcagagtctggttatattttattctaccagtcaaga
gagtga

DBGET integrated database retrieval system