KEGG   Gallus gallus (chicken): 422866Help
Entry
422866            CDS       T01006                                 

Gene name
ABLIM2
Definition
(RefSeq) actin binding LIM protein family member 2
  KO
K07520  
actin-binding LIM protein
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
4
AA seq 667 aa AA seqDB search
MSTGTVSQPQAVHSQLEKPSSTAILCNTCGKPCKGEVLRVQNKYFHIKCFVCKACGCDLA
QGGFFVRQGDYICTLDYQRLYGTRCFSCDEFIEGEVVSALGKTYHPDCFVCAVCRLPFPA
GDRVTFNGKECICQKCSLPPSSSTGSFPVQNLRNCGGCGSEIKNGQSLVALDKHWHLGCF
KCNTCGKLLNAEYISKDGIPYCETDYHAKFGIRCDNCEKYITGRVLEAGEKHYHPTCARC
VRCCQMFAEGEEMYLQGTSIWHPVCRQAAKTEEKNKETRTSSESIISVPASSTSGSPSRV
IYAKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISYSSDDRHSYGEGDQDDRSFK
QYRTSSPSSAGSLGYGRYTPTSHSPQHYSRPAGTQSLGTSSCISLPQHPSPTSTFRHHYI
PFFKGSESGRSTPSLSMYSDSKSSPSVYQQAPRHFHIPDTGVKDNIYRKPPIYKQHALRR
SEGEDGSLDQDNKKLKTSWLILKGDMDTRTNSPDSDTRSLSLTPGTDRENFQRAQEGTTA
MYSRFPYSKSTSLPGYGRNGLHQPENMSQYETDQEASWGMKEYKVRRAFPTLEEQSDSAL
PSKIYPYETLIVTNRVRVKLPKDVDRTRLERHLSPEEFQEVFKMSIEEFDRLALWKRNDL
KKKALLF
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccggcacagtttcacaaccgcaggctgtacacagccaactggagaagccatca
agtactgcaattctctgcaatacctgtggaaaaccatgcaaaggagaagttttgagagtt
cagaacaaatatttccatattaagtgctttgtttgcaaagcttgtggatgtgacctggct
caaggaggatttttcgtgagacagggagactacatctgtactttggactaccagagactc
tatggcacacggtgcttcagttgtgatgaattcattgagggagaagtggtctcagcactg
ggcaaaacctatcacccagactgttttgtgtgtgctgtctgcaggctgcctttccctgca
ggtgaccgggtaacttttaatggcaaagagtgcatctgccagaagtgctccctgccccct
tccagcagcactggctctttccctgtacagaacctgcgaaattgtggaggctgtggttca
gaaataaaaaatgggcagtcattggttgccttggacaaacactggcatttgggctgtttt
aagtgcaatacatgtggcaagctactgaacgcagagtacatcagcaaggatggcattcca
tattgcgaaacggactatcatgcaaagtttggtatcagatgtgacaattgtgaaaaatat
attacaggaagagtgcttgaggcgggagaaaaacattatcatcctacttgtgcacgatgt
gtcaggtgctgtcagatgtttgcagaaggagaagaaatgtatcttcaaggtacatccatc
tggcatccagtttgtagacaggctgctaagactgaagaaaaaaacaaggaaacaaggact
tcctctgagagtataatttctgtacctgcttcaagtacatcaggttccccaagccgtgtg
atctatgcaaagcttggagatgaaattcttgactacagggatttggctgctcttcctaaa
aataaagccatctataacattgaccgcccagatatgatctcctattctccatatatcagt
tactcttcagatgacaggcatagttacggggagggtgaccaagatgacagatccttcaaa
cagtacaggacatcaagtccaagctctgctggctcactgggttatggtcgctacactcca
acatcccattctcctcagcattatagtaggccagctggtactcagagtcttggtaccagt
agctgcatctccctgccccaacacccaagccctacatctacattcagacatcattacatc
cctttcttcaaaggcagtgaaagtggtcggagcactccaagcttatccatgtactcagac
agcaaatcttcaccttctgtctatcagcaggctcctaggcatttccatattccagacact
ggcgtaaaagataacatctataggaaacctcctatctacaaacagcatgcactaagaaga
tcagaaggggaggatggaagtctggatcaggacaacaagaagctgaagaccagttggctt
attctgaaaggggatatggacaccagaactaattccccagattcagatacccgatccctg
tctcttactcctggaactgacagagaaaacttccagagagcacaggagggcaccactgcc
atgtactcccgatttccgtattctaaatctacttctctacctgggtatggaaggaatggc
ttgcatcagcctgaaaacatgagccaatatgaaacagaccaggaggcgagctgggggatg
aaagaatacaaggtaagaagggcttttccaacactggaagaacaatcagattcagcactt
cctagcaagatttatccttatgagacacttattgtaacaaaccgagttcgtgtgaaattg
cccaaggatgtggacaggaccagactggagagacatttgtcccctgaggagttccaggaa
gtcttcaaaatgagcattgaagagtttgatcgcctggcactttggaagcggaatgacctg
aagaaaaaggccctgcttttctag

DBGET integrated database retrieval system