KEGG   Gallus gallus (chicken): 422897Help
Entry
422897            CDS       T01006                                 

Gene name
WHSC1
Definition
Wolf-Hirschhorn syndrome candidate 1
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    422897 (WHSC1)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     422897 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 1395 aa AA seqDB search
MDFSIKRSSQLLTRKINYLKMKQVPEILGNTNGKTQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHDALPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKTTNKERRNRKRSIKYDSLLE
QGLVEAALVSKTSSSPENKAPAKRDSTQSTIKDDKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPILHSYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVPFKGKDQFEQLCQESAK
QALTKAEKIKMLKPVPGKLRPQWEMGVKQASEAVGMTVEERKAKYTFIYIRDRPHLNPQV
AKEVGIAVELLEEEVDESSYSNEETSENLKSMKESGIPNKRRRRTSKLSATDDTQESSQL
ETKNTTPQKSSEQAESKRGIGSPLSRKKTPASTPRSRKGDAVSQFLVFCQKHRDEVVAEH
PDASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGSSLKNIGEAKRKVFQD
SPKRRSRSRSNLHGNKRNQKKRTKEPTEDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKT
NSTKVTETSSSQKNQSATKNLSDACKPLKKRNRASAAESSTLAFSKSSSPSASLTENEIF
DGPGDERSESPYESADETQTEVSISSKKSERGTGTKKEYVCQLCEKTGDLLLCEGLCYRA
FHVSCLGLSGRPAGKFVCSECTSGVHTCFVCKERKADLKRCVVSHCGKFYHEACVKKFHL
TVFESRGFRCPLHSCLSCHVSNPSHPRISKGKMMRCVRCPVAYHAGDVCIAAGCAVIASN
SIVCTNHFTAMKGKSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYC
NDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYF
WTHQARVFPYMEGDRGSRYRGIKGIGKVFKNALQEAEARFREIKLQREAKETQESERKPP
PYKHIKVNKPCGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMYECHPQVCPAG
ERCQNQCFTKREYPETEIIKTDGKGWGLVAKRDIKKGEFVNEYVGELIDEEECMARIKYA
HENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDI
PAGTELTFNYNLDCLGNEKTVCKCGAPNCSGFLGDRPKNSSTNASEEKGKKTKKRTRRRR
TKNEGKKESEDDCFRCGDGGQLVLCDRKSCTKAYHLSCLDLAKRPFGKWECPWHHCDVCG
KPSVSFCHFCPNSFCKEHQDGTVLNSTLNGQLCCSEHVLGVDSVETQKTEKPRKKLNKLK
PKRKERNRWMRAECK
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaacttttaactcgaaaaattaactacttaaaa
atgaagcaagtaccagagatccttggaaataccaatgggaaaactcagaattgtgaagtg
aatcgtgagtgttctgtctacttgggcaaagcacaactttctgccactctacaggaaggt
gtcatgcaaaaatataacggccacgacgctcttccattcatcccagctgataagttgaaa
gatctaacttctcgtgtgttcaatggcgagtccggggcccaggatgccaagctgcgcttt
gaaccccaggaaataaaaggagttggaacaccaccaaacactactcctatcaagaatggt
tctccagaaatcaagctgaaaatcactaaaacctacatgaatggaaaacctctgtttgag
tcttccatttgtggagacaatggtgcagatgtgtctcaatcagaggaaaatgaacaaaaa
acaacaaacaaggagaggagaaacagaaaaagaagcataaaatatgactccttacttgag
cagggtcttgttgaagcagcgttggtgtcaaagacttcaagctcccctgaaaataaggct
cctgctaagagagattcaacacaaagtaccatcaaagatgacaaagtccatctgttgaag
tataatataggagatctagtgtggtcaaaagtatcaggttttccttggtggccatgtatg
gtttctgctgatcctattcttcattcctacactaaactaaaaggacagaaaaagagtttt
cgtcagtatcatgttcagttttttggagatgctccagaacgagcctggatatttgagaag
agccttgtgcctttcaaaggaaaagatcaatttgaacaattatgccaggaaagtgcaaaa
caagccctcactaaagcagagaaaataaagatgttaaagcctgttccagggaagctgcga
ccgcagtgggagatgggtgttaagcaagcaagtgaagcagtaggcatgacagtggaagaa
cggaaggccaaatacaccttcatctacattagggacagacctcatcttaatcctcaagtg
gcaaaggaagttggcattgctgtggagcttttagaggaggaggtagatgagtcatcttac
tcaaatgaagaaacctccgaaaatctgaaatcaatgaaggagtctggcattcctaacaag
aggaggagaaggacatcaaaattgtctgccactgatgatacacaagaaagcagtcagttg
gagactaagaatactactcctcaaaagtcatctgaacaggctgaatccaaaagagggata
ggctcccctctgagtagaaagaaaactccagcatctactccacgaagcagaaagggcgat
gcagtatctcagtttttggtcttctgtcagaagcacagagatgaggtggttgctgaacat
cccgatgcatcaagtgaggagattgaagagttgcttgaatcgcagtggaacatgcttagt
gaaaaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaa
gaagactctggttcatcattgaagaatattggagaggccaaacgtaaagtgtttcaagac
tcacctaaaaggagatcaagatccagaagtaacttacatggaaataaaagaaaccaaaaa
aagaggacaaaggaacctacagaagattttgaagttcaggaggcacctaggaaaagactc
aggatggataaacagaataatcggaagagggagacaagcaatgacaaaacagcaaaaaca
aactctactaaggtcacagaaacctcctcttcacaaaagaaccagtcagcaacgaaaaat
ctgtctgatgcatgtaaacctctgaagaagcgaaatcgggcttcagcagcagaatcttca
actcttgcttttagcaaaagttcatctccttcagcttccttaactgagaatgagatcttc
gatggcccaggagatgagcgctcagagtctccctatgaaagcgctgatgaaactcagact
gaagtgtctatctcatccaaaaaatctgagcgaggaacgggaacaaaaaaagaatatgtg
tgtcagctctgtgaaaaaacaggtgatctcctgctgtgtgaaggactttgctatcgagct
tttcacgtgagctgccttgggctctctggaagaccagcaggaaaatttgtttgtagcgaa
tgtacatcaggtgtgcatacctgctttgtgtgtaaagagaggaaggcagacctgaagcgc
tgcgttgtatcccactgtggaaaattctaccatgaggcctgtgtgaagaaattccacctg
accgtgtttgagagcaggggttttcggtgtcctctgcacagctgcctcagttgtcatgtt
agtaacccctcccatccacgaatttcaaaaggaaagatgatgcgctgtgttcgctgtcct
gttgcataccatgctggagacgtgtgcattgctgcgggatgtgcagtcatcgcttccaac
agcattgtttgtacgaaccatttcactgccatgaaaggaaaaagtcatcacgcgcatgtc
aatgtgagctggtgctttgtgtgttccaaaggaggaagcttgctgtgctgcgagtcctgt
cctgcagcgtttcacccggactgcttaaacatcgaaatgccagatgggagctggtactgc
aatgactgcagggcggggaagaaactccatttccaggatattatttgggttaagctggga
aattacaggtggtggcctgctgaagtttgccatccgaaaaacgttcccccaaacatccag
aaaatgaagcatgaaatcggagaatttcctgtgtttttctttggttctaaggattacttt
tggactcaccaagcacgggtgttcccttatatggagggagacagagggagtcgataccgg
gggattaaaggaattggaaaagtcttcaaaaatgctttgcaagaagctgaagctcgattt
cgagaaataaagctacagcgagaagccaaagaaacccaagaaagtgaacgtaaacctccc
ccatacaagcatattaaggtgaataagccttgtggtaaagtgcagatatatacggctgac
atttctgagattcccaagtgcaactgcaagcccacagatgaaaacccttgtggctttgac
tctgagtgcctcaatcggatgttgatgtatgaatgtcatccacaagtttgtccagcagga
gaacgatgccaaaaccagtgctttacaaaacgtgaataccctgagacagagatcatcaaa
acagatgggaaagggtggggtttagttgcaaagagggacattaagaagggagagtttgtg
aatgagtatgttggtgagctcattgatgaagaggaatgtatggcaagaatcaaatatgca
cacgaaaatgacattactcacttctatatgcttactattgataaggaccgtattattgac
gctggccccaaaggaaactattctcgttttatgaatcacagctgccaaccaaattgtgaa
actctaaaatggacggtaaatggagatactcgtgttggcctgtttgctgtgtgtgatatt
cctgcagggacagagctgactttcaattacaaccttgactgtctgggcaatgaaaaaaca
gtctgcaaatgtggtgccccaaactgcagtggatttcttggggacagaccaaagaactct
tccactaatgcctcagaagaaaaaggcaaaaagaccaaaaagagaacacggaggcgtaga
acaaaaaacgaagggaagaaagaatctgaagatgattgtttccgttgtggtgatggaggc
cagctggtgttgtgcgacaggaaatcctgtactaaagcctatcatctctcctgtcttgat
ttggcgaaacgtccttttgggaagtgggagtgtccttggcaccactgtgatgtttgtggc
aaaccttctgtttcattctgccacttctgcccgaattctttttgcaaggaacaccaagat
gggacagtactaaattctacgttgaatggacagttatgctgctctgaacacgttctcggg
gtggattctgttgaaactcagaagactgagaaaccccgcaaaaaactgaacaagttgaag
cctaagagaaaggagaggaacagatggatgagagccgaatgcaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system