KEGG   Gallus gallus (chicken): 422899Help
Entry
422899            CDS       T01006                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    422899 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 890 aa AA seqDB search
MSLQILNAENGENVSDDLTAEECGFYFALPEPTERPSILRLSQKENLPPKSVAKAMKVTF
QTPLRDPQSRKILSPTMTDKLDSTFTLDDCSEALQDDLTMPISTVISQQKTEASDTEINK
QMPEKVSAAPYPDDEMPVKSRGSYNLDFDNLNDINPFQSSMQLQNSPGNLQKSPVRVSSS
PEKTSEESSNSLPLDNTASPSTTASTEYPSEQDNTFSSGKKSVLLELESNKPDLFPKQAI
SGSLQESPSTEVSQIDKSSSLDVISSEVTYSKTGESKLQNVPVPEKASTEELKPLEEPAI
SKGEPAEKPGVTKAGPVKLEFDFENTSVRKPPPKKLGKRLGIKPPSKKTFSTKLKTENTE
VENKSNVEDEAPVPRASYKFDWDKLDDPNFNPFGGGSKISTSPKCSEPSSQKVPQQEEQH
STPPRREHLPVEQDNRPTSCEILEKKEPRSPEIHKQNVLEDEPQKQEDKPEVQGQTDLPG
ELSMEKQISPSKMSPANVPSQDNLVSADSGKRSMPAEEIKPTSHKNEITADQQTASAEPE
ELFRPSAEVLGMGIDYLEQFGTSSFKESALRKQSLYLKFDPLLRDSPRKQPIFGTIEANT
DIMTAPLQCGPISDLSKLLEETEKPTSSLQNEEKPKGLDLLGTFTTPDPGPLIPDSLARD
VSPLPFTASTNAAVDAIIDVLKYSQKDMDAAVELVKREVQEKELEALEWKKKYNKLHMEY
KEMGKVVAEFEGTITQMMEDSQKQKELSKKEIQRMVEEKQQVISDLNSMEKSFSELFKRF
EKQKEVLEGYRKNEEALKKCAEEYLARIKKEEQRYQALKAHAEEKLHQANEEIAQVRNKA
KSETAALQASLRKEQMRIQSLERSLEQKTKENDELTKICDDLILKMGKNG
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagatcttaaatgcagaaaatggagaaaacgtcagtgatgatctaacagcg
gaagagtgtggcttttactttgcactaccggaacctacagagagaccttctattctgcgc
ctatcccagaaagaaaacttgccaccaaaaagtgtggcaaaagctatgaaggtaaccttt
caaactcctctaagagatcctcagtctcgaaaaatattaagtcctaccatgacagacaaa
cttgactctactttcacgcttgacgattgcagtgaagccttgcaggatgatctaactatg
cccatcagcactgtcataagtcaacagaagactgaagcaagtgatacagagataaataaa
caaatgccagagaaagtcagtgctgctccttacccagatgatgagatgccagtgaagagc
cgaggttcctacaatcttgattttgataacttaaatgacatcaatcccttccagagttca
atgcagctgcagaactctcctggaaatctgcagaagtctcctgtaagggtatctagcagc
cctgagaaaacttctgaagaaagtagcaattctcttccactggataatacagcttctcct
tcaacaacggcaagtacagagtaccccagtgaacaggataatactttttcctctggaaaa
aaatctgttctgttagagttggagtctaataaacctgatctgttcccaaagcaagctatc
agtggctctctgcaggagtctccttccacagaagtaagccaaatcgataagtctagcagt
ttggatgttattagttccgaagtgacctattccaaaactggggaatcaaagcttcaaaat
gttcctgtaccagaaaaagcttcaacagaagagttgaagccgttagaagagcctgctatc
tccaaaggggaacctgccgaaaagcctggtgtcaccaaggctggaccagtaaaactggaa
tttgactttgagaacaccagtgttagaaaaccacctcctaagaaactaggtaagagactt
ggaattaagccaccttccaaaaaaacttttagtaccaaactgaaaacagagaatactgaa
gtggaaaataaaagtaatgtggaagatgaagctcctgttcctagagcgtcctataagttt
gactgggacaaacttgatgatccaaactttaatccatttggaggaggctctaaaatttcc
acctcacccaagtgttctgagcccagctctcagaaagttccccagcaagaggagcagcat
agtaccccaccaagaagggagcatcttccagtggagcaggataacagaccaactagctgt
gaaattctggagaaaaaagaaccaagaagtccggaaatccacaaacaaaatgtgttagaa
gatgagccacaaaagcaagaagacaagccagaagttcaaggacagactgatcttccagga
gagctatccatggagaagcaaataagcccatctaaaatgtctccagcaaatgtcccctct
caagataatttagtttctgctgacagtggaaaaaggtcaatgcctgcagaagaaattaaa
cctacttctcacaaaaatgaaataacagccgatcagcagacagctagcgctgaacctgaa
gagctcttcagaccatcagcagaagttctcggaatgggcatagactatctggagcaattt
ggaacttcatctttcaaagagtctgctttgaggaagcaatcgttgtatttgaagtttgat
cctctgttgagagacagtcccaggaagcaaccaatttttggtactattgaagcaaataca
gatatcatgactgctccacttcagtgtggtcctatttctgatctaagcaaactgcttgaa
gaaactgagaagcctacatcaagtcttcaaaatgaggaaaaaccaaaaggactagatctt
ctaggaacatttacaactcctgaccctggtcccttaattccagactccctggcacgtgat
gtttctccactcccttttactgcttccacaaatgctgcagtggacgctattatagatgtg
ctgaaatacagccaaaaagatatggatgcagctgttgaactagttaaaagagaggttcaa
gagaaagagttggaggctcttgaatggaaaaagaagtacaacaagcttcacatggaatac
aaggaaatgggaaaagtagttgcagagtttgaaggtacaataacccaaatgatggaggat
tctcagaaacagaaggagctttcaaagaaagaaatacagaggatggtggaagaaaagcag
caagttatttcagatctgaactctatggagaaatctttctctgaactcttcaagcgtttt
gaaaaacaaaaagaagtgctggagggttaccgcaaaaatgaagaggctttgaaaaaatgt
gctgaagaatatctggctagaattaagaaagaggaacagagataccaggcactaaaggca
catgctgaagaaaagctgcatcaagcaaatgaggaaatcgcccaggtacgaaacaaagct
aaatcagaaactgcagccctacaagccagtctccgcaaagaacaaatgaggatccagtct
ttagagaggagccttgaacaaaagacaaaagaaaatgatgaactaacgaagatctgtgat
gacttgattttgaagatgggaaaaaatggatag

DBGET integrated database retrieval system