KEGG   Gallus gallus (chicken): 422982Help
Entry
422982            CDS       T01006                                 

Gene name
DHCR7
Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00100  Steroid biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    422982 (DHCR7)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     422982 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT Orf78 AOX
Motif
Other DBs
NCBI-GeneID: 422982
NCBI-ProteinID: NP_001186419
CGNC: 3011
Ensembl: ENSGALG00000004106
UniProt: F1P4X7
Position
5
AA seq 474 aa AA seqDB search
MAAHREKKSEERNHKSAQNGAQAPQAQWGRAWEVDWFSLASILFLLAFAPLIVYYFIMSC
DQYQCSLTDPLINLLMGNKHLSDIWNKTPSLTYTAAGIYAAWVAFQVMLYVFVPDFCHKF
LPGYVGGVQEGAVTPAGVVNKYEINGLQAWIITHVLWFANAYYFHYFSPTIIFDNWIPLL
WCANILGYVVSTFAMIKGYFFPTNAKDCKFTGNFFYDYMMGIEFNPRIGKWFDFKLFFNG
RPGIVAWTLINLSYAAKQQELYGHVTNSMILVNVLQGIYVLDYFWNEAWYLKTIDICHDH
FGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLCTANAIGILALGLVGYYIFRMTNHQKDLF
RRTNGNCKIWGKKPDYIECSYMSVDGTKYYSKLLTSGFWGWARHFNYTGDLMGSLAYCLT
CGFEHILPYFYIVYMTILLTHRCIRDEHRCYSKYGKDWKRYTAAVPYRLIPGLF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccatcgggagaaaaagtctgaagaaagaaatcacaaaagtgcccaaaatggt
gctcaggctcctcaagcacagtggggaagagcatgggaggtagactggttttccttggca
agcattcttttcctacttgcatttgcaccgcttatcgtgtattacttcatcatgtcctgc
gaccagtaccagtgctctctgactgatccactcatcaacttgcttatggggaataaacat
ctgtctgacatctggaacaagaccccttcactgacttatacggctgctggaatctatgct
gcttgggttgctttccaggtgatgttgtatgtgtttgttcctgacttctgccacaagttt
cttcccggatatgtaggaggtgtacaagaaggtgctgtcactcctgctggtgtagtaaat
aagtatgaaatcaatggactccaagcttggatcattacccatgtactttggtttgcaaat
gcctactatttccactacttctcacctactatcatttttgacaattggattcctctcctg
tggtgtgccaatatcctgggatatgtggtttccacatttgcaatgattaaaggctacttt
ttccctactaatgccaaagattgcaaattcactggcaacttcttttacgactacatgatg
gggattgaatttaaccctcgaataggaaagtggtttgatttcaagctgttcttcaatgga
cgccctggtattgtagcctggactctgattaacctttcttatgctgctaaacagcaggag
ctgtatggtcatgtaaccaactcaatgatccttgtcaatgtccttcagggtatttatgtt
ttggactatttctggaatgaagcctggtatttgaaaaccattgatatctgccacgatcat
tttggatggtacttgggctggggagactgtgtttggttgccttacctctacactctgcag
ggtttatatttggtttaccaccctgtgcaactctgcacagctaatgccatcgggatcttg
gcgttgggcttggttggctattacatcttcagaatgacaaaccaccagaaagatctcttc
cgccgtaccaatggcaactgcaagatatgggggaagaagcctgactacattgaatgctcc
tacatgtctgtagatgggaccaagtactacagcaagctgctgacttcggggttctggggg
tgggcacgccattttaactacactggagatctgatgggctccctggcctattgtctgacc
tgtgggtttgaacacatcttgccttacttctacattgtttatatgactattctgctaact
caccgttgcattagggatgaacaccgttgttatagcaaatacgggaaagattggaaacgc
tacactgctgcagtaccctaccggctcataccagggctgttttaa

DBGET integrated database retrieval system