KEGG   Gallus gallus (chicken): 423014Help
Entry
423014            CDS       T01006                                 

Gene name
PLCB2
Definition
phospholipase C, beta 2
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    423014 (PLCB2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    423014 (PLCB2)
   04020 Calcium signaling pathway
    423014 (PLCB2)
   04070 Phosphatidylinositol signaling system
    423014 (PLCB2)
 Cellular Processes
  Cell communication
   04540 Gap junction
    423014 (PLCB2)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    423014 (PLCB2)
   04916 Melanogenesis
    423014 (PLCB2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423014 (PLCB2)
   04270 Vascular smooth muscle contraction
    423014 (PLCB2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     423014 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
5
AA seq 1211 aa AA seqDB search
MSVLTPVLQPPEVKEYLSKGERFIKWDDETASASPVILRVDPKGXYLYWTYQNKEMEILD
ITSIRDTRVGRFAKIPKCQKLREVFNLDYPHSTFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKSWAEDIMAIVQNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPETVYKTFLMNLCPRPEIDEIFTSHHFKAKPYMTKEH
LAKFINKKQRDSRLNDILFPPAKPEQVQSLIEKYEPSVINIQRGQLSPEGMVWFLCGPEN
NVIALDKLVLYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKM
AEYCRTIFGDMLLTEPLEKYPLKPGVPLPSPKDLLGKILIKNKKKQSVSEKRQNSMKKGK
NVEPEIIEQPAFMDAEDTVWAGDVAEEEPEEEDDQLGNLDEEEIKKMQSDEGTAGLEVTA
YEEMSSLVNYIQPIKFDSFEVSAQKNRSYVISSFTELKAYDLLTKFPMQFVEYNKRQMSR
IYPKGTRMDSSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQCGYLLKHEFMR
RPDKQFDPFSVDRIDVVVASTLSVTILSGQFLSDRSVKTYVEVELFGLPRDTKRKYRTKL
TSTANSINPVWKEEPFVFEKIMMPELASLKIVAFEEGGKFIGHRVIPIIAVHSGYHHVCL
RSESNMPLTMPSLFVYLEVKDYVPDAWADLTIALSNPIKFFSLQEKRSVNLKDGSEVERP
DMQRNFSFPENNGIPESTRKFSTPFANGPAGAAALVKDGNMKEVTQLAEPQTASLAELQQ
MKLFLKLLKKQEKELKELERKGSKRREELLQKYSLLFLEPVCPGGKKRSIHSRKTQKKRS
LTTGDVGTCVHPVEMAESLDSRVLELKERLEMELIHLGEEYHDGIRRRKEQHATEQTAKI
TELAREKQTAELKALKESSESNIKDVKKKLEAKRLERIQVMMRSTNDKAAQERLKKEINN
SHIQEVVQTIKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAAAEYEEKLRGLTVE
VQEMVKNCVKEVFPDGPEIQKEAVLSIPVEEQSSTKQLEEKIPGAEVSRLTAATAEPPGA
ETDITIEESIL
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgcttacccctgtcctgcagcccccagaggtgaaggagtatctgtccaagggc
gaacgcttcatcaaatgggacgatgaaacagcaagtgcttctcctgtgattcttcgggtg
gatccaaagggcntttatttatactggacgtatcagaacaaggagatggaaattctggat
ataaccagcatccgagacacccgagtagggcgatttgccaaaatccccaagtgccagaag
ctccgcgaggtctttaacttggattaccctcacagcacctttctgctgaaaactctgacc
gttgtgtctggccctgacatggtggacctcactttccataacttcgtgtcctacaaggag
aacgttggcaagagctgggctgaggatatcatggccattgttcagaatcccctcacatac
aacgcttctcggtacaccttcctagaaaaaatcctggtgaagctgaagatgcagctgaac
gcagagggaaagattcctgtcaggaatatttttcagatgtttcctgcagacaggaagagg
gtggaagcagcattaagcgcttgtcatcttccaaaaggcaagaatgatgccatcaaccca
gaggacttccctgagactgtgtataaaactttcctcatgaatctgtgcccacggcctgag
attgatgagatatttacttcacaccatttcaaagcaaaaccctacatgaccaaagaacac
ttggcaaagtttatcaacaagaagcagcgagactctcgcctcaacgacatccttttccca
ccagcaaaacctgagcaggtgcagagcctgatagagaaatatgagcccagtgtcattaac
atccagagagggcagttgtctccagagggaatggtctggtttctctgcggccctgagaac
aacgtgatagcactggacaaattggtgctgtatcaggacatgacacagcccctctcacac
tacttcatcaattcgtcccacaacacttatttaacagctggccagttttctggtatctcc
tctcccgaaatgtaccgtcagacgctgctggccgggtgtcgctgtgtggagctggattgc
tggaagggccgtcccccagatgaggagcccatcatcactcacgggttcaccatgacaact
gaaatcctcttcaaggatgccattgaggccattgcagaaagtgctttcaaaacatccctt
taccctgtcatcctctcctttgagaaccatgtggactcgcccaagcagcaggcaaagatg
gctgagtactgccgaaccatatttggagatatgctgctgacagagcctctggagaaatac
ccactgaagccaggagttcctctgccgagtcctaaggatctcttagggaaaatcttaatt
aagaacaaaaagaaacagtctgtgtctgagaagaggcagaattctatgaagaaggggaag
aatgtggaaccagaaatcatcgagcagccagcttttatggatgctgaagatactgtctgg
gcaggagatgtggctgaagaggaaccagaggaagaggacgatcagctaggaaacctggat
gaagaggaaataaaaaagatgcagtcagatgagggcactgctggtttggaagtgacagca
tatgaggaaatgtccagcctcgttaattacatacagcccatcaagtttgactcctttgaa
gtctctgcccagaagaaccggagttacgtcatctcttccttcaccgagctgaaggcttac
gatctgctgaccaagttccctatgcagtttgtggaatacaacaagcgccagatgagccgg
atttaccccaaaggcacccggatggactcctccaattacatgccccagatgttctggaac
gttggctgtcagatggtggcactgaacttccagaccatggatgtccccatgcagcagaac
atggctctgtttgagttcaatggccagtgtggctatctgctcaagcatgaattcatgcgg
cgcccagacaagcagtttgaccctttctccgtggaccgcattgatgtggtggtggcaagc
accctgtctgtcacgatactttctggtcaattcctctcagaccgcagtgtgaagacgtat
gtggaagtggagctgtttgggctgccaagggacacgaagcgcaaatacagaaccaaactg
acctccactgccaattccatcaatcctgtttggaaagaagaaccttttgtttttgaaaag
atcatgatgcctgagctggcatcgctcaaaattgtggcttttgaggaaggagggaagttc
attggtcatcgtgtcattcccattattgcagtacactcaggctatcaccatgtttgtctc
cgcagtgaaagcaatatgccactcaccatgccctctctatttgtgtacctggaagtaaag
gattacgtccctgatgcctgggcagatctgactattgctctctccaacccaattaagttc
ttcagtctgcaagaaaagagatcagttaatctaaaagatggctcggaggtggagaggcct
gacatgcaaaggaacttctcattccctgaaaataatgggataccagagtccaccaggaaa
ttcagcaccccttttgcaaatgggcctgcaggagcagcagctctggtcaaggatggaaac
atgaaggaagtgacacagcttgcagagcctcagacagccagccttgcagagctgcagcag
atgaagctgttcctgaagctgctgaagaagcaggagaaagagctgaaggagctggagcgg
aaaggaagtaaacggagagaagagttgctgcagaaatattctcttctctttttggagcct
gtctgccccggaggcaagaaaagatccatacactccagaaaaacccagaagaagaggagt
ttgacgacaggtgatgttggtacctgcgtgcatcctgtggaaatggcagaaagccttgat
agccgagttttggagctgaaagagaggctggagatggagcttatccacctgggggaagaa
taccatgatgggattcgaagaaggaaagagcagcatgccacagagcaaacggccaagata
acagagctagccagagagaagcagacagctgagctgaaggcactgaaggagtcatcagaa
agcaacattaaagatgttaagaagaagctggaggcaaaacgattagaacgaatccaagtc
atgatgaggagtactaatgacaaggctgctcaggagaggttgaagaaagaaattaataac
tctcacatccaggaagtggtccaaacaatcaaactgctgacagaaaagacagccaggtat
cagcagaagctggaagagaagcaggcagagaatctgagagcaatccaagagaaagaaggc
cagctccagcaggaggcagcggcagaatacgaggagaaattgagaggtctgacagtggag
gtgcaggagatggtgaagaactgtgtgaaagaagtctttcctgatgggccggagattcag
aaggaagcagttctgagcattcccgtggaagaacaaagctctacaaagcaactggaagag
aagatccctggggcagaggtgtcaaggctgacagcagctacggctgagcctccaggagcc
gaaacagacatcaccattgaggaaagcatactgtga

DBGET integrated database retrieval system