KEGG   Gallus gallus (chicken): 423112Help
Entry
423112            CDS       T01006                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gga00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 452 aa AA seqDB search
MKTKFCNGEADPSPLGLLLGCDPGSGGGGVVLPAAGQPPSPLSHGGPEGKDPAAAGRGGG
AVSPTSPVPPPPEEEPPLDPRTRRRAYLWCKEFLPGAWRGLREEQLLISPIRGGLSNMLF
XCSLPDSIETVADEPRKXLLRLYGAILQMRSCNKGESEQSQKENDLQGAEAMVLESVMFA
ILAERALGPKLYGIFPQGRLEEFIPSRKLSTEELSLPDISAEIAEKMAIFHGMKMPFNKE
PKWLFGTMEKYLNQVLRIKFTRESKTRKLNKLLSYNLPQEMKNLRAMLEATSSPVVFCHN
DCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFKAS
VLKYPSKKQQLHFISSYLSAFQDGFENLSNEEKSKLEEDMLVEVNRFALASHFFWGLWSI
IQAKISSIEFGYLEYALSRFDVYFDQKKKLQV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaagttctgtaacggcgaggccgacccctctccgctcgggctcctcctgggc
tgcgaccccggctccggcgggggcggcgtcgtcctccccgccgccgggcagcccccctcg
ccgctctcccacggcggccccgaggggaaggatcccgcggcggcgggcaggggcgggggt
gccgtgagcccgacctcccccgtgccgccgccgcccgaggaggagccgccgctcgacccc
cgcacgcggcgcagggcctatctgtggtgcaaggagttcctgccgggggcctggcgcggg
ctgcgggaggagcagctcctcatcagccccatcagaggtggcctcagcaacatgctgttc
nagtgctcgctacctgattccattgagacagttgcagatgagccacggaagnttctgctg
cgcttatatggtgcaatcctgcagatgaggtcctgtaataaaggagaatcagaacagtct
caaaaggaaaatgacttgcaaggggcagaagccatggttttggagagcgttatgtttgcc
attcttgcagagagagctcttggcccaaagctgtatggaatctttccacaggggagacta
gaggagtttattcccagcaggaaactaagtactgaagaactaagcttgcctgacatatct
gctgaaatagctgagaagatggcaatatttcatggcatgaaaatgccatttaataaagaa
cctaagtggctttttgggacaatggaaaagtatctaaaccaagtgctgaggataaaattt
actagagaatccaaaactaggaaactgaacaaactcctcagttacaatctaccccaggaa
atgaaaaatctaagagctatgcttgaggctacttcatcaccagttgtattttgccacaac
gactgccaggaaggtaatatcttgcttctagaaggcagagagaattcagaaaaacaaaag
ctgatgctcattgactttgaatacagcagctataattaccgaggctttgacattgggaat
cacttctgtgagtggatgtatgattacacatatgagaagtatccattcttcaaagctagc
gttcttaaatatccttcaaagaagcaacagcttcattttatctccagttacctgtctgca
ttccaagatggttttgaaaatctgagcaatgaagagaagtccaaactagaagaagatatg
ttggtagaagttaataggtttgccctcgcgtcacacttcttctggggtttgtggtctatt
atacaagcaaagatctcatccattgaatttggttacctggaatatgcattatccagattc
gatgtgtactttgatcagaagaagaagctccaagtatga

DBGET integrated database retrieval system