KEGG   Gallus gallus (chicken): 423195Help
Entry
423195            CDS       T01006                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
gga  Gallus gallus (chicken)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:gga04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:gga04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 490 aa AA seqDB search
MHNLSAQPWQAKMANLTYDNVTLSNRSEVAIQPPTNYKTVELVFIATVTGSLSLVTVVGN
ILVMLSIKVNRQLQTVNNYFLFSLACADLIIGVFSMNLYTVYIIKGYWPLGAVVCDLWLA
LDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWILSFILWAPAILF
WQFIVGKRTVHERECYIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVRRHK
PESRKERKGKSLSFFKAPPVKQNNNNSPKRAVEVKEEVRNGKVDDQPSAQTEATGQQEEK
ETSNESSTVSMTQTTKDKPTTEILPAGQGQSPAHPRVNPTSKWSKIKIVTKQTGTESVTA
IEIVPAKAGASDHNSLSNSRPANVARKFASIARSQVRKKRQMAAREKKVTRTIFAILLAF
ILTWTPYNVMVLINTFCETCVPETVWSIGYWLCYVNSTINPACYALCNATFKKTFKHLLM
CQYRNIGTAR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacctctccgcgcagccctggcaggcgaagatggccaacctgacctatgacaac
gtcaccctcagcaaccgctctgaggtggccatccagccccccaccaactacaagacggtg
gagctggttttcatcgccacggtcaccggctcgctcagcctcgtcaccgtggtggggaac
atcctggtgatgctgtccatcaaagtgaaccgccagctccagactgtcaacaactacttc
cttttcagcctggcctgcgccgacctcatcatcggagtcttctccatgaacctctacact
gtctacatcatcaaaggctactggccactgggggccgtggtgtgcgacctgtggctggcc
ctggactacgtggtgagcaacgcctcggtcatgaacttactcatcatcagcttcgaccgg
tacttctgtgtcactaagcccctgacgtacccagccaggaggaccaccaagatggcgggg
ctcatgatcgcagccgcgtggatattgtccttcattctctgggcccctgccatcttgttc
tggcagttcattgtgggcaagaggacagtccacgagagggaatgctacatccagttcctc
tccaacccggcggtgaccttcggcacggccatcgctgctttctacctgcccgtggtcatc
atgacggtgctgtacatccacatctcgctggccagcaggagcagggtgaggagacacaag
cccgaaagcaggaaagagaggaaaggcaagtccctcagcttcttcaaggctcccccagtc
aaacagaacaacaataactcccccaagagggccgtggaggtgaaagaggaggtgaggaat
gggaaggtggacgaccagccctcagcacagacagaggccactggccagcaggaggagaag
gagacctccaatgagtccagcacagtcagcatgacccagaccaccaaagacaagcccaca
acggaaatcttgccagcgggacaaggacagagcccggcccatcctcgggtgaacccgact
tccaagtggtccaagatcaaaatcgtcaccaagcagactgggaccgaatcggtcaccgcc
atcgagatcgtcccagctaaggcaggagcctctgaccacaactccctgtccaacagccgc
cctgccaatgtcgccaggaagtttgccagcatcgccaggagccaagtgcggaagaagcgc
cagatggcagcccgggagaagaaggtcacccggaccatatttgccatcctgcttgccttc
atactcacgtggactccgtacaatgtgatggtcctcattaacaccttttgcgagacctgc
gttcctgaaaccgtgtggtccatcggctactggctctgctatgtcaacagcaccatcaac
ccagcctgctatgccctctgcaatgccacgttcaagaaaacctttaagcacctcctcatg
tgccagtacaggaacattggcacggccagataa

DBGET integrated database retrieval system