KEGG   Gallus gallus (chicken): 423272Help
Entry
423272            CDS       T01006                                 

Gene name
ARG2
Definition
arginase, type II
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gga01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gga00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 356 aa AA seqDB search
MALRGGFARLFRRRADAGLRPPRRAHSVALVGAPFSRGQKRRGVDHGPATLRAAGLVERL
AGLGCQLYDFGDLNFTQVPNDELYNNLIYYPRSVGLASQVLADAVSRAVAAGHSCVTIGG
DHSLALGSVSGHARQCPHLGVIWVDAHADINTPLTTQSGNLHGQPLSFLLRELQDKVPQL
PGFSWLKPCLSASDIVYIGLRDVDPAEYYILKNYDIQYFSMRDVDRLGIQKVMERTFEQL
MGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIAEEIHNTGMLSAVDMVEVN
PLLGASQEEVNATASLAVDVIATCFGQTREGAHTAFDELPTPSSPDESDSEQQVRI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgcggcggcttcgcgcggctcttccgcaggcgggcggacgcggggctgcgg
cccccccggcgggcgcactcggtggcgctggtgggcgccccgttctccagggggcagaaa
cggcgcggagtggaccacggccccgctactctccgcgccgcggggctggtggagcggctg
gccgggctcggatgccaactgtacgactttggagatttgaatttcactcaagttcccaat
gatgaactgtacaacaacctgatttattacccacggtcagtggggttagccagccaggta
ctggctgatgctgtaagcagagcggtagctgctggacacagctgtgtcactataggaggt
gatcacagcttggcacttggttctgtcagcggccatgcacgacagtgcccacatctcggt
gtgatctgggtggatgcgcatgctgatattaacactcctcttacaactcagtctggaaac
ctccatgggcagcctctctcatttctcttgagagaacttcaagataaagtcccacagctt
cctggcttttcctggctaaagccctgtctttcagcatctgatattgtgtacattgggttg
agggatgtggatcctgctgaatactatattttgaaaaactatgacatccagtatttttcc
atgagggatgttgatcgccttggaatccagaaagttatggaaaggacttttgaacagctg
atgggcaggagacagagaccaattcacttgagctttgacatcgatgcttttgatccctca
ctggctccagcaacaggaactcctgttctaggtggattaacttacagagaaggcatgtac
attgcagaggaaatacacaacacaggaatgctttcagctgtagacatggttgaagtcaat
ccactgcttggagcttctcaagaggaagtgaatgcaactgctagtcttgcagttgatgtg
atagcaacgtgctttggacagacgagagaaggggcgcacactgcttttgatgaactccca
acacccagttctccagatgaatctgacagtgaacagcaagtgaggatttaa

DBGET integrated database retrieval system