KEGG   Gallus gallus (chicken): 423272Help
Entry
423272            CDS       T01006                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00220  Arginine biosynthesis
gga00330  Arginine and proline metabolism
gga01100  Metabolic pathways
gga01230  Biosynthesis of amino acids
Module
gga_M00029  Urea cycle
gga_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    423272 (ARG2)
   00330 Arginine and proline metabolism
    423272 (ARG2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     423272 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 423272
NCBI-ProteinID: NP_001186633
CGNC: 7246
Ensembl: ENSGALG00000009519
Position
5
AA seq 356 aa AA seqDB search
MALRGGFARLFRRRADAGLRPPRRAHSVALVGAPFSRGQKRRGVDHGPATLRAAGLVERL
AGLGCQLYDFGDLNFTQVPNDELYNNLIYYPRSVGLASQVLADAVSRAVAAGHSCVTIGG
DHSLALGSVSGHARQCPHLGVIWVDAHADINTPLTTQSGNLHGQPLSFLLRELQDKVPQL
PGFSWLKPCLSASDIVYIGLRDVDPAEYYILKNYDIQYFSMRDVDRLGIQKVMERTFEQL
MGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIAEEIHNTGMLSAVDMVEVN
PLLGASQEEVNATASLAVDVIATCFGQTREGAHTAFDELPTPSSPDESDSEQQVRI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgcggcggcttcgcgcggctcttccgcaggcgggcggacgcggggctgcgg
cccccccggcgggcgcactcggtggcgctggtgggcgccccgttctccagggggcagaaa
cggcgcggagtggaccacggccccgctactctccgcgccgcggggctggtggagcggctg
gccgggctcggatgccaactgtacgactttggagatttgaatttcactcaagttcccaat
gatgaactgtacaacaacctgatttattacccacggtcagtggggttagccagccaggta
ctggctgatgctgtaagcagagcggtagctgctggacacagctgtgtcactataggaggt
gatcacagcttggcacttggttctgtcagcggccatgcacgacagtgcccacatctcggt
gtgatctgggtggatgcgcatgctgatattaacactcctcttacaactcagtctggaaac
ctccatgggcagcctctctcatttctcttgagagaacttcaagataaagtcccacagctt
cctggcttttcctggctaaagccctgtctttcagcatctgatattgtgtacattgggttg
agggatgtggatcctgctgaatactatattttgaaaaactatgacatccagtatttttcc
atgagggatgttgatcgccttggaatccagaaagttatggaaaggacttttgaacagctg
atgggcaggagacagagaccaattcacttgagctttgacatcgatgcttttgatccctca
ctggctccagcaacaggaactcctgttctaggtggattaacttacagagaaggcatgtac
attgcagaggaaatacacaacacaggaatgctttcagctgtagacatggttgaagtcaat
ccactgcttggagcttctcaagaggaagtgaatgcaactgctagtcttgcagttgatgtg
atagcaacgtgctttggacagacgagagaaggggcgcacactgcttttgatgaactccca
acacccagttctccagatgaatctgacagtgaacagcaagtgaggatttaa

DBGET integrated database retrieval system