KEGG   Gallus gallus (chicken): 423347Help
Entry
423347            CDS       T01006                                 

Definition
acyl-CoA synthetase short-chain family member 1-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    423347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    423347
   00620 Pyruvate metabolism
    423347
   00640 Propanoate metabolism
    423347
Enzymes [BR:gga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     423347
Lipid biosynthesis proteins [BR:gga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   423347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 682 aa AA seqDB search
MAWLLTRACCPKALPWTSRCLCRLVSTRSWSQGPLTAYMPEAVSFPGTQDHQSLYKTSVE
RGDAFWGALARSRLTWITPFHSVQDCDLHQGRAAWFLGGQLNVAVNCLDRHVHVAPDKVA
LIWEKDEPGEEVRVTYRELLELTCRLSNTLKRQGVKRGDRVTIYMPPCPLAVASMLACAR
IGAVHAVVFAGFSAESLADRIRDAQSETVITVNQGLRGGKVVELKKTVDQAVKQCPGVKR
VLVSMRTDSQLSMTALDVLLEEEMMKEDAYCEPVAMDSEDMLFLLYTSGSTGKPKGLVHS
QAGYLLFAALTHKYVFDYQDRDVFGCVADIGWITGHTYVVYGPLCNGGTTVLFESTPVYP
DPGRYWETVERLKINQFYGAPTAIRLLLRYGDEWVKKYDRSSLRVLGSVGEPINKEAWEW
YFRVVGEARCPVVDTWWQTETGGICISPRPSNPGDEILPGMAMRPFFGISPSVLDDKGNV
LLENNVSGALCISQAWPGMARTIYKDHKRFVETYLAPYPGFFFTGDGVYRTSEGYYQLTG
RLDDIINISGHRLGTAEVEDVVNHHVAVAESAVIGYPHEIKGEGAYVFVVLKKDSKYMEE
TLAAELRELISKKIAKYAVPEYIQVTHRLPKTRSGKIMRRVLRKIVENKASELGDLTTLD
DHEAVQQIIEGHKHLVEGRKRC
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcctggctgctgactagggcttgctgtcccaaagctcttccttggacttccagatgt
ctctgcaggttagtgagcactcggtcctggagccagggccctctcaccgcctacatgcca
gaagctgtctccttccctggaacccaggatcaccagagcttgtacaagacatcggtggag
cggggggatgccttctggggagcgctggcaaggagccggctcacctggatcacccccttc
cactctgtccaggactgtgatctgcaccagggccgggctgcctggttcctgggggggcag
ctcaatgtggcagtgaactgcttggaccgacatgtccatgtagccccagacaaagtggcc
ttaatctgggagaaggatgaaccaggagaggaggtgcgggtcacatacagggagctgctg
gagctgacatgccgcctgagcaacaccctgaaacggcaaggggtgaaacgaggtgacagg
gtgacaatctacatgcccccgtgcccactggcagtagccagcatgctggcctgtgcccga
ataggggctgtgcacgccgttgtgttcgctgggttcagtgcagagtccctggcagacagg
atccgggatgcccagtcggagacggtgatcacggtgaaccaggggctgagaggtggcaag
gttgtggagctgaagaaaacagtggatcaggctgtgaagcagtgcccaggagtgaaacgt
gtcctcgtgtccatgaggacagacagccagctttccatgacagccctggatgttctgctg
gaggaggagatgatgaaggaggatgcatactgtgagcctgttgccatggacagtgaagac
atgttgttccttctctacacatctggaagtacaggcaagcccaagggcctggttcattcc
caggctggctacctcctgtttgctgctctcacacacaagtacgtgtttgactaccaggac
agggatgtctttggctgcgtggcagacattggctggatcacagggcacacttacgttgtc
tacggccccctttgcaatggtggcaccacagtcctttttgagagcactcccgtctatccc
gaccctggacgctactgggaaacagtggagaggttaaaaattaatcagttttacggggcg
cctaccgccatccgcctgctcctgagatacggtgatgaatgggtgaagaaatacgaccgc
tcctctcttagagttcttggctcagtgggtgaacccatcaacaaggaggcatgggagtgg
tacttccgtgtggtgggtgaggcacggtgccctgttgtggacacgtggtggcaaacagaa
acaggaggcatctgtatctcaccccgtccttctaaccctggagatgaaatccttccaggc
atggccatgagacctttttttggcatcagcccctctgtactggatgataagggaaatgtc
cttttggaaaataatgtctctggagccctttgcatctcacaagcctggccgggtatggca
cgaaccatttataaagaccataagaggtttgtggaaacctatttggctccttatccaggg
ttcttcttcactggggatggtgtatatcgcactagtgaaggctattaccagctgacagga
cggctggatgacatcattaacatcagtgggcatcggctgggcactgcagaggtggaggat
gttgtgaaccaccatgtggcagtggcagaatctgctgtgatcggctacccacatgagatc
aagggagaaggagcctacgtgtttgttgtgctgaagaaggacagcaagtacatggaggaa
actcttgctgctgagctacgggagctgatctccaagaagatcgctaagtatgcggttcca
gagtacattcaggtcacacaccggctgcccaagacgcgctctgggaagattatgcggcgg
gtgctaaggaagattgttgaaaacaaagccagtgagcttggggacctaaccaccctagat
gaccatgaagctgtgcagcagatcatagagggacacaagcaccttgtggaggggcggaag
aggtgctag

DBGET integrated database retrieval system