KEGG   Gallus gallus (chicken): 423347Help
Entry
423347            CDS       T01006                                 

Definition
acyl-CoA synthetase short-chain family member 1-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gga01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gga00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gga00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gga00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 682 aa AA seqDB search
MAWLLTRACCPKALPWTSRCLCRLVSTRSWSQGPLTAYMPEAVSFPGTQDHQSLYKTSVE
RGDAFWGALARSRLTWITPFHSVQDCDLHQGRAAWFLGGQLNVAVNCLDRHVHVAPDKVA
LIWEKDEPGEEVRVTYRELLELTCRLSNTLKRQGVKRGDRVTIYMPPCPLAVASMLACAR
IGAVHAVVFAGFSAESLADRIRDAQSETVITVNQGLRGGKVVELKKTVDQAVKQCPGVKR
VLVSMRTDSQLSMTALDVLLEEEMMKEDAYCEPVAMDSEDMLFLLYTSGSTGKPKGLVHS
QAGYLLFAALTHKYVFDYQDRDVFGCVADIGWITGHTYVVYGPLCNGGTTVLFESTPVYP
DPGRYWETVERLKINQFYGAPTAIRLLLRYGDEWVKKYDRSSLRVLGSVGEPINKEAWEW
YFRVVGEARCPVVDTWWQTETGGICISPRPSNPGDEILPGMAMRPFFGISPSVLDDKGNV
LLENNVSGALCISQAWPGMARTIYKDHKRFVETYLAPYPGFFFTGDGVYRTSEGYYQLTG
RLDDIINISGHRLGTAEVEDVVNHHVAVAESAVIGYPHEIKGEGAYVFVVLKKDSKYMEE
TLAAELRELISKKIAKYAVPEYIQVTHRLPKTRSGKIMRRVLRKIVENKASELGDLTTLD
DHEAVQQIIEGHKHLVEGRKRC
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcctggctgctgactagggcttgctgtcccaaagctcttccttggacttccagatgt
ctctgcaggttagtgagcactcggtcctggagccagggccctctcaccgcctacatgcca
gaagctgtctccttccctggaacccaggatcaccagagcttgtacaagacatcggtggag
cggggggatgccttctggggagcgctggcaaggagccggctcacctggatcacccccttc
cactctgtccaggactgtgatctgcaccagggccgggctgcctggttcctgggggggcag
ctcaatgtggcagtgaactgcttggaccgacatgtccatgtagccccagacaaagtggcc
ttaatctgggagaaggatgaaccaggagaggaggtgcgggtcacatacagggagctgctg
gagctgacatgccgcctgagcaacaccctgaaacggcaaggggtgaaacgaggtgacagg
gtgacaatctacatgcccccgtgcccactggcagtagccagcatgctggcctgtgcccga
ataggggctgtgcacgccgttgtgttcgctgggttcagtgcagagtccctggcagacagg
atccgggatgcccagtcggagacggtgatcacggtgaaccaggggctgagaggtggcaag
gttgtggagctgaagaaaacagtggatcaggctgtgaagcagtgcccaggagtgaaacgt
gtcctcgtgtccatgaggacagacagccagctttccatgacagccctggatgttctgctg
gaggaggagatgatgaaggaggatgcatactgtgagcctgttgccatggacagtgaagac
atgttgttccttctctacacatctggaagtacaggcaagcccaagggcctggttcattcc
caggctggctacctcctgtttgctgctctcacacacaagtacgtgtttgactaccaggac
agggatgtctttggctgcgtggcagacattggctggatcacagggcacacttacgttgtc
tacggccccctttgcaatggtggcaccacagtcctttttgagagcactcccgtctatccc
gaccctggacgctactgggaaacagtggagaggttaaaaattaatcagttttacggggcg
cctaccgccatccgcctgctcctgagatacggtgatgaatgggtgaagaaatacgaccgc
tcctctcttagagttcttggctcagtgggtgaacccatcaacaaggaggcatgggagtgg
tacttccgtgtggtgggtgaggcacggtgccctgttgtggacacgtggtggcaaacagaa
acaggaggcatctgtatctcaccccgtccttctaaccctggagatgaaatccttccaggc
atggccatgagacctttttttggcatcagcccctctgtactggatgataagggaaatgtc
cttttggaaaataatgtctctggagccctttgcatctcacaagcctggccgggtatggca
cgaaccatttataaagaccataagaggtttgtggaaacctatttggctccttatccaggg
ttcttcttcactggggatggtgtatatcgcactagtgaaggctattaccagctgacagga
cggctggatgacatcattaacatcagtgggcatcggctgggcactgcagaggtggaggat
gttgtgaaccaccatgtggcagtggcagaatctgctgtgatcggctacccacatgagatc
aagggagaaggagcctacgtgtttgttgtgctgaagaaggacagcaagtacatggaggaa
actcttgctgctgagctacgggagctgatctccaagaagatcgctaagtatgcggttcca
gagtacattcaggtcacacaccggctgcccaagacgcgctctgggaagattatgcggcgg
gtgctaaggaagattgttgaaaacaaagccagtgagcttggggacctaaccaccctagat
gaccatgaagctgtgcagcagatcatagagggacacaagcaccttgtggaggggcggaag
aggtgctag

DBGET integrated database retrieval system