KEGG   Gallus gallus (chicken): 423357Help
Entry
423357            CDS       T01006                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00020  Citrate cycle (TCA cycle)
gga00310  Lysine degradation
gga01100  Metabolic pathways
gga01200  Carbon metabolism
Module
gga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gga_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    423357 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    423357 (DLST)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     423357 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-GeneID: 423357
NCBI-ProteinID: NP_001012919
CGNC: 51956
Ensembl: ENSGALG00000010286
UniProt: Q5F326
Position
5
AA seq 461 aa AA seqDB search
MLLLWRSRCLGRALGRSVRTLRQGNCTLARRSLSGVAGSQGLAYIDNRKLIVNSSSVFTV
RYFRTTAVHRDDVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPA
PAAGVIEALLVPDGGKVEGGTPLFKLRKTGAAPAKAKPAAAPPPPPAAPEPVAAAPPPPA
AAPIPTTMPPVPPVSAQPIGSKPVSAVKPAAAPVAAPPGEAVPSKGARSEHRVKMNRMRQ
RIAQRLKEAQNTCAMLTTFNEIDMSNIREMRAVHKDPFLKKHNLKLGFMSAFVKASAFAL
QDQPIMNAVIDDTTKEIVYRDYVDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGE
KARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPPFHRDMPNT
RLRNSPQQLSLNHSILMDGSACEGLTCYQQRAGGGGAGLQV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgtggcggtcgcgctgcttgggccgggcgctgggccgctcggtgcgcacc
ctccggcagggcaactgtactctggcaagacgctccctgtctggtgtggctggcagccag
ggactggcttacatcgacaacaggaagctcatagtaaatagctccagtgtcttcactgtc
cgttacttcagaaccacagcagtacatagggatgacgtggttacggtgaacaccccagct
tttgcagagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtg
gcggaagatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagcc
ccagcagctggtgtgattgaagcccttttggtacccgatggtggcaaagtggaagggggg
acacctctgttcaaactcaggaaaactggagctgctcctgccaaggccaaaccagcagca
gcccctcctcctcctcctgcagcacctgaacctgtagctgccgctcctcctcctcctgct
gcagcaccaattcccactacaatgccaccagtgccacctgtgtcagctcagcccattggc
agcaaaccagtgtctgcagtgaagccggctgcagctccagtggcagcacctcctggggag
gcagtgcccagcaaaggtgccagatcagagcatagggtgaaaatgaataggatgcgtcag
cgtatcgcccagcggctgaaggaggctcagaacacttgtgccatgctgaccactttcaat
gagattgatatgagcaacatccgggagatgagagctgtacacaaggatcccttcctgaaa
aagcacaacctgaaattaggtttcatgtcagcttttgtcaaagcttcagcttttgctcta
caggaccagcctattatgaatgcagtaatcgatgacacgaccaaagagattgtgtacagg
gactatgtggacatcagtgtagctgtagcaactccccggggtcttgtggtccctgtcgtt
aggaatgtagaaaacatgaactttgctgacatagagcgagctatctatgagctgggggaa
aaggcacggaagaacgaactggctattgaagacatggatggtggcacttttacaatcagc
aatggaggggtttttgggtcactctttgggacacctatcatcaacccaccgcagtctgct
atcttaggcatgcatgccatctttgacaggccaccctttcaccgtgacatgcccaacact
aggctaagaaacagcccccagcagctgtccttgaatcacagcatactgatggatgggtct
gcgtgtgagggcttgacctgctaccagcagagagctgggggggggggggctggtctgcaa
gtgtaa

DBGET integrated database retrieval system