KEGG   Gallus gallus (chicken): 423357Help
Entry
423357            CDS       T01006                                 

Gene name
DLST
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gga  Gallus gallus (chicken)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    423357 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    423357 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    423357 (DLST)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     423357 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 461 aa AA seqDB search
MLLLWRSRCLGRALGRSVRTLRQGNCTLARRSLSGVAGSQGLAYIDNRKLIVNSSSVFTV
RYFRTTAVHRDDVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPA
PAAGVIEALLVPDGGKVEGGTPLFKLRKTGAAPAKAKPAAAPPPPPAAPEPVAAAPPPPA
AAPIPTTMPPVPPVSAQPIGSKPVSAVKPAAAPVAAPPGEAVPSKGARSEHRVKMNRMRQ
RIAQRLKEAQNTCAMLTTFNEIDMSNIREMRAVHKDPFLKKHNLKLGFMSAFVKASAFAL
QDQPIMNAVIDDTTKEIVYRDYVDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGE
KARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPPFHRDMPNT
RLRNSPQQLSLNHSILMDGSACEGLTCYQQRAGGGGAGLQV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgtggcggtcgcgctgcttgggccgggcgctgggccgctcggtgcgcacc
ctccggcagggcaactgtactctggcaagacgctccctgtctggtgtggctggcagccag
ggactggcttacatcgacaacaggaagctcatagtaaatagctccagtgtcttcactgtc
cgttacttcagaaccacagcagtacatagggatgacgtggttacggtgaacaccccagct
tttgcagagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtg
gcggaagatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagcc
ccagcagctggtgtgattgaagcccttttggtacccgatggtggcaaagtggaagggggg
acacctctgttcaaactcaggaaaactggagctgctcctgccaaggccaaaccagcagca
gcccctcctcctcctcctgcagcacctgaacctgtagctgccgctcctcctcctcctgct
gcagcaccaattcccactacaatgccaccagtgccacctgtgtcagctcagcccattggc
agcaaaccagtgtctgcagtgaagccggctgcagctccagtggcagcacctcctggggag
gcagtgcccagcaaaggtgccagatcagagcatagggtgaaaatgaataggatgcgtcag
cgtatcgcccagcggctgaaggaggctcagaacacttgtgccatgctgaccactttcaat
gagattgatatgagcaacatccgggagatgagagctgtacacaaggatcccttcctgaaa
aagcacaacctgaaattaggtttcatgtcagcttttgtcaaagcttcagcttttgctcta
caggaccagcctattatgaatgcagtaatcgatgacacgaccaaagagattgtgtacagg
gactatgtggacatcagtgtagctgtagcaactccccggggtcttgtggtccctgtcgtt
aggaatgtagaaaacatgaactttgctgacatagagcgagctatctatgagctgggggaa
aaggcacggaagaacgaactggctattgaagacatggatggtggcacttttacaatcagc
aatggaggggtttttgggtcactctttgggacacctatcatcaacccaccgcagtctgct
atcttaggcatgcatgccatctttgacaggccaccctttcaccgtgacatgcccaacact
aggctaagaaacagcccccagcagctgtccttgaatcacagcatactgatggatgggtct
gcgtgtgagggcttgacctgctaccagcagagagctgggggggggggggctggtctgcaa
gtgtaa

DBGET integrated database retrieval system