KEGG   Gallus gallus (chicken): 423373Help
Entry
423373            CDS       T01006                                 

Gene name
POMT2
Definition
(RefSeq) protein O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
gga  Gallus gallus (chicken)
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    423373 (POMT2)
   00514 Other types of O-glycan biosynthesis
    423373 (POMT2)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     423373 (POMT2)
Glycosyltransferases [BR:gga01003]
 O-Glycan biosynthesis
  O-linked Man type
   423373 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
5
AA seq 660 aa AA seqDB search
MGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFPFQKPGDRYEQHNYMGMRGFCAFL
GSFLVPFAYLTVLELSKSLPAALLTAFILIFDTGCITLSQYILLDPILMFFLMGAVLSMV
KCNSCADRPFSASWWLWLSLTGVNLAGAMGVKFVGLFVVLLVGLNTIYDLWDLLGDLNLS
LVMFGKHFLARVLCLILLPLTLYMAMFAVHFAVLNKSGPGDGFFSSAFQSQLIGNNLHNV
SIPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGVGARQQQVTAYLHKDLNNLWIIKKHD
SNTADLSDSSSPVEFVRHGDIIRLEHKETSRNLHSHQHEAPLTRKHFQVTGYGINGTGDS
NDFWRIEVVGRRTGKLIKVLRSKIRLMHVATGCILGSTGKTLPKWGWEQVEVTCTPYVKE
TPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHMVMIRGNSGLKPKDNEVTSKPWHW
PINYQGLRFSGVNETDYRVYLLGNPVVWWLNLFTIGLYLLIAISTAVALKRGVQLTSEHK
ELSRVVLCGGGQVALGWLLHYLPFFMMGRVLYFHHYFPAMLFSSMLTGITWDTLLKFFSQ
FLSPSTKARRVYGVGILALILLIMYSFYLFHPLSYGMIGPMASDPSSPMAGLRWMDSWEF
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggaagttactacattaaccggaccttcttctttgatgtccatcctcctttggggaag
atgctgattggacttgctggctacctgagtggatatgatggaacgtttcctttccaaaag
ccaggggacagatacgaacagcacaactacatgggaatgagagggttctgtgcattcctt
ggctccttcctggtaccctttgcctacctcacagtgctggagctgtccaagtcactgcca
gcagccttactcacagctttcatccttatttttgatacaggctgtattactttgtctcag
tatattctgcttgaccccattctgatgttcttccttatgggagctgttctgagtatggtg
aagtgtaactcctgtgcagataggccattctctgcctcctggtggctctggctgagtctg
acaggggtgaaccttgctggagcaatgggggtgaagtttgttggcctttttgtagtcctg
ctggttggtctgaacacaatctatgacctttgggacttgctgggggacctcaatttgtca
ctagtcatgtttgggaagcatttcctggctcgagtgctctgcctcatcttgcttccgctc
accctctacatggcaatgtttgctgttcattttgcagtattaaataaaagtggccctggg
gatggtttcttcagttctgcctttcagtcccagctgattgggaacaatctccataatgtc
tccattccagagcatttggcctatgggtctgtggtcacgatgaagaaccttcggatggca
gggggttaccttcactcccactggcacctctacccagagggcgtcggggctcgccagcag
caggtcacagcctacttacataaggatttgaataacctgtggattataaagaagcatgat
tcaaatacagcagatctgtcggattcctccagccctgtggagtttgtgaggcatggagac
atcattcgcctggaacataaagaaacttctagaaatcttcacagtcaccagcatgaggct
cccctgacaaggaagcactttcaggtcactggctatggcataaatggaacaggagattcc
aatgacttctggcggattgaggtggtgggcaggaggactgggaagcttatcaaagtccta
cggagtaagatccggctaatgcatgtggccacagggtgtattctgggctctactggaaag
actctaccaaagtggggttgggaacaagtggaagtcacctgcacgccatacgtgaaagag
actcccaattcactctggaactttgaagatcatataaaccctaagttgcctaatatcagc
ctggatgttttgaagccttcttttgcggaaattctgctggaatcccacatggttatgatc
cggggaaacagtggcctgaaaccaaaggacaatgaagttacatccaaaccctggcactgg
cccatcaactaccagggtctgcgtttttctggtgtcaatgagacagattatcgggtttat
ttgctgggaaacccggtggtatggtggctgaatctgttcactattgggctgtatcttctg
atagcgatttccactgcagtggcactgaagaggggtgtccaactgacttctgaacacaaa
gaactgtctcgagttgtgctctgtggcggagggcaggttgctctgggctggctccttcat
tacctgcccttcttcatgatgggccgagttctctactttcaccactactttcctgccatg
cttttttccagcatgttgacaggaatcacctgggacacactactgaagtttttttctcag
ttcttgtcacccagcactaaagctagaagagtttatggagtggggatcctggcactgatt
ctgctcatcatgtacagcttctacctcttccatcctctgtcctacgggatgataggaccc
atggcatctgaccccagcagccccatggcagggctccggtggatggactcctgggagttc
tag

DBGET integrated database retrieval system