KEGG   Gallus gallus (chicken): 423394Help
Entry
423394            CDS       T01006                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
gga  Gallus gallus (chicken)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gga00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:gga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
5
AA seq 674 aa AA seqDB search
MEFVRLSLCPAALLCAWLLLGSSWGLGPPGVGAAYVLDDAGGLGREFDGIGAISGGGATS
RLLVNYQEPYRSQILDYLFKPNFGASLHILKVEIGGDGQSTDGTEPSHMHYENDENYFRG
YEWWLMKEAKKRNPQIKLIGLPWTFPSWIGKGEDWPYDYPHVTVYYIISWILGAKQYHDL
DIDYIGIWNERAFNSKYIKVLRQSLDKLGLSNIGIIAADGDWNISKEMIVDPYLNDAVQV
VGAHYPGTKTVPNALLTQKKLWASEDYSTFNDEVGAGCWARILNQNYVNGNMTSTIAWNL
VASYYEELPFGRCGLMTAQEPWSGYYKVEAPIWITAHTTQFTQPGWSYLQVDGHLEGGGS
FVALTDGLGNLTIIIETMTHNHSKCIRPPLPHFRVSPQRATFYLRGSFYFLETLQVWYSK
LGFESANSSLFEQLHPVKVWRGSFALDLDVDEVYTLTTLKTGRKCSCPEPPPPQPFPSNY
KDDFNIRNPPFSEAPNFADQTGVFEYFVNGSDPGDHVFTLRQVVIQRPITWVSDADQTIS
IIGNFQWVNLTVTCDIYIEKPIDGGVFIAGRVDNGGIYVRRTKGVFFWVYADGTYRVTSD
LAGEEILMKGLSGVRHNAWHTLTLNIQGTSASGLLNGYPLWENVTISQPSHGWAAIGTRS
FEFAQFDNFHVEAR
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtcaggctttctctctgtcctgcggctctgctctgtgcttggctcctgctt
ggctctagctggggcttggggccccccggggtcggtgctgcctacgtgctggacgatgcc
ggcgggctgggcagggagttcgacgggatcggggcgatcagcggcggcggggccacatct
agactccttgtgaactaccaagaaccatatcgctcccagatcttagattatctgttcaag
ccaaattttggtgcttctttacacattctcaaagtagaaattggtggtgatggacaatca
acagatggcactgagccctcccatatgcactacgagaatgatgagaactacttccgaggt
tatgagtggtggctgatgaaagaagctaaaaagaggaatccccaaataaaactgattgga
ttaccctggacatttccatcatggatagggaagggtgaagactggccctatgattatcca
catgtcactgtttactatattatttcttggatattaggagctaaacagtatcatgacctg
gatattgattatattgggatatggaatgaaagggcatttaacagcaaatatatcaaggta
cttcggcagtctttagacaaactgggtctaagcaacattggcatcatcgctgcggatgga
gattggaacatttcaaaggagatgatagttgacccatatcttaatgatgctgttcaggta
gttggggctcactatcctgggacaaaaacagtgccaaatgccttactaactcagaagaaa
ctctgggcttcggaagattatagtactttcaacgatgaagtaggtgcaggctgctgggct
cggatcctaaaccaaaactacgtgaatggaaacatgacctcaactattgcatggaactta
gtggcaagttattatgaagaactgccctttggtcgatgtggtttgatgacagcacaagaa
ccgtggagtggctactataaagtagaagcaccaatctggattacagcacacacaacacaa
tttactcagccaggctggtcatacttgcaagtggacggacatttagaaggaggtggaagc
tttgtagctctgacagatggcctaggaaaccttaccattataatcgaaactatgacgcat
aatcactctaaatgtatcaggcctccactgcctcacttccgagtttcacctcagagagca
actttctacctcagagggtctttttatttcctggaaactcttcaggtgtggtactctaag
cttggttttgaatctgcaaactctagtctttttgagcaacttcatcctgtaaaggtctgg
aggggaagttttgctttagacctagatgtggatgaagtctacactttaactacacttaag
acaggacggaagtgtagctgcccagagcctccaccacctcaaccttttccttcaaattac
aaagatgattttaatattcgtaatccgcctttcagtgaagctccaaattttgcagatcag
acgggtgtgtttgagtacttcgtaaatggctctgacccaggagatcatgttttcacactc
cgacaggtggtgattcagcgacccatcacttgggtttctgatgcagaccagacaatcagc
atcatcggaaacttccagtgggtaaatctgacagtcacttgtgacatctacatagaaaag
ccaattgatggaggtgtgttcattgctggaagagttgacaatggtgggatatatgttcgt
cgtaccaaaggagttttcttctgggtttatgcagatggcacctacagagtcactagtgac
ctggctggagaagaaatattaatgaaagggctttctggtgtccgacataatgcttggcac
acgcttactcttaacatccagggcacttctgcctcaggactgttaaatggttatccactc
tgggagaatgtcaccatttctcaaccaagtcatggctgggctgctattggaactcgctca
tttgagtttgcacagtttgacaacttccatgttgaagctagatga

DBGET integrated database retrieval system