KEGG   Gallus gallus (chicken): 423394Help
Entry
423394            CDS       T01006                                 

Gene name
GALC
Definition
(RefSeq) galactosylceramidase
  KO
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
gga  Gallus gallus (chicken)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    423394 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    423394 (GALC)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     423394 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
5
AA seq 675 aa AA seqDB search
MEFVRLSLCPAALLCAWLLLGSSWGLGPPGVGAAYVLDDAGGLGREFDGIGAISGGGATS
RLLVNYQEPYRSQILDYLFKPNFGASLHILKVEIGGDGQSTDGTEPSHMHYENDENYFRG
YEWWLMKEAKKRNPQIKLIGLPWTFPSWIGKGEDWPYDYPHVTVYYIISWILGAKQYHDL
DIDYIGMWHEGAFNSKYIKLLRYTLDKNGLQKVRIIASDRLWEPISFVMLIDSELHEVVD
VIGAHYPGTKTVPNALLTQKKLWASEDYSTFNDEVGAGCWARILNQNYVNGNMTSTIAWN
LVASYYEELPFGRCGLMTAQEPWSGYYKVEAPIWITAHTTQFTQPGWSYLQVDGHLEGGG
SFVALTDGLGNLTIIIETMTHNHSKCIRPPLPHFRVSPQRATFYLRGSFYFLETLQVWYS
KLGFESANSSLFEQLHPVKVWRGSFALDLDVDEVYTLTTLKTGRKCSCPEPPPPQPFPSN
YKDDFNIRNPPFSEAPNFADQTGVFEYFVNGSDPGDHVFTLRQVVIQRPITWVSDADQTI
SIIGNFQWVNLTVTCDIYIEKPIDGGVFIAGRVDNGGIYVRRTKGVFFWVYADGTYRVTS
DLAGEEILMKGLSGVRHNAWHTLTLNIQGTSASGLLNGYPLWENVTISQPSHGWAAIGTR
SFEFAQFDNFHVEAR
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtcaggctttctctctgtcctgcggctctgctctgtgcttggctcctgctt
ggctctagctggggcttggggccccccggggtcggtgctgcctacgtgctggacgatgcc
ggcgggctgggcagggagttcgacgggatcggggcgatcagcggcggcggggccacatct
agactccttgtgaactaccaagaaccatatcgctcccagatcttagattatctgttcaag
ccaaattttggtgcttctttacacattctcaaagtagaaattggtggtgatggacaatca
acagatggcactgagccctcccatatgcactacgagaatgatgagaactacttccgaggt
tatgagtggtggctgatgaaagaagctaaaaagaggaatccccaaataaaactgattgga
ttaccctggacatttccatcatggatagggaagggtgaagactggccctatgattatcca
catgtcactgtttactatattatttcttggatattaggagctaaacagtatcatgacctg
gatattgattatattgggatgtggcatgaaggggcatttaacagcaaatatatcaagctg
ttgaggtacacactggataagaatggtctgcagaaggtgaggatcatagccagcgataga
ctgtgggagcccatttcctttgtcatgctgattgactctgagctccacgaagtggtcgat
gtcattggggctcactatcctgggacaaaaacagtgccaaatgccttactaactcagaag
aaactctgggcttcggaagattatagtactttcaacgatgaagtaggtgcaggctgctgg
gctcggatcctaaaccaaaactacgtgaatggaaacatgacctcaactattgcatggaac
ttagtggcaagttattatgaagaactgccctttggtcgatgtggtttgatgacagcacaa
gaaccgtggagtggctactataaagtagaagcaccaatctggattacagcacacacaaca
caatttactcagccaggctggtcatacttgcaagtggacggacatttagaaggaggtgga
agctttgtagctctgacagatggcctaggaaaccttaccattataatcgaaactatgacg
cataatcactctaaatgtatcaggcctccactgcctcacttccgagtttcacctcagaga
gcaactttctacctcagagggtctttttatttcctggaaactcttcaggtgtggtactct
aagcttggttttgaatctgcaaactctagtctttttgagcaacttcatcctgtaaaggtc
tggaggggaagttttgctttagacctagatgtggatgaagtctacactttaactacactt
aagacaggacggaagtgtagctgcccagagcctccaccacctcaaccttttccttcaaat
tacaaagatgattttaatattcgtaatccgcctttcagtgaagctccaaattttgcagat
cagacgggtgtgtttgagtacttcgtaaatggctctgacccaggagatcatgttttcaca
ctccgacaggtggtgattcagcgacccatcacttgggtttctgatgcagaccagacaatc
agcatcatcggaaacttccagtgggtaaatctgacagtcacttgtgacatctacatagaa
aagccaattgatggaggtgtgttcattgctggaagagttgacaatggtgggatatatgtt
cgtcgtaccaaaggagttttcttctgggtttatgcagatggcacctacagagtcactagt
gacctggctggagaagaaatattaatgaaagggctttctggtgtccgacataatgcttgg
cacacgcttactcttaacatccagggcacttctgcctcaggactgttaaatggttatcca
ctctgggagaatgtcaccatttctcaaccaagtcatggctgggctgctattggaactcgc
tcatttgagtttgcacagtttgacaacttccatgttgaagctagatga

DBGET integrated database retrieval system