KEGG   Gallus gallus (chicken): 423572Help
Entry
423572            CDS       T01006                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04150  mTOR signaling pathway
gga04510  Focal adhesion
gga04540  Gap junction
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    423572 (SOS2)
   04012 ErbB signaling pathway
    423572 (SOS2)
   04068 FoxO signaling pathway
    423572 (SOS2)
   04150 mTOR signaling pathway
    423572 (SOS2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    423572 (SOS2)
   04540 Gap junction
    423572 (SOS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    423572 (SOS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    423572 (SOS2)
   04912 GnRH signaling pathway
    423572 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_13 PH_10 PH_9
Motif
Other DBs
NCBI-GeneID: 423572
NCBI-ProteinID: XP_015132223
CGNC: 9322
Ensembl: ENSGALG00000012273
UniProt: F1N8Q9
Position
5
AA seq 1330 aa AA seqDB search
MQPPPQPYEFFGEENGPKWRGLFVPALRKVQQQVHPNLSAKEDSLYYIEELILQLLNKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRNEIAEERQYLRELNLIIKVFREAFLSNRKLFTPNDI
DVVFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNNLMAKPAVALYFQSTAEGFKEAVRYVLPRLMLIPVYHCLHYFELLQQLQE
CSEDEEDRECLKQAITALLNLQCSMERIYSKHSPRRRPGEPVCRFYNRQIRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGTLTKIGAKHERHIFLFDGLMISCKTNHGQSRLPG
YSNAEYRLKEKIIMRKIQIIDKDDTSEYKHAFELVSKDENSILFAAKSAEEKSNWMAALI
SLQYRSTLDRMLDSVLLQEENEQPLRLPSPNVYRFVVEDSEDNIVFEDNLQSRNGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLETFISSVR
GKSMKKWVESIAKIIKRKKAQANGISHNITFESPPPPIEWHIWRVGHSEMLDLMTLHPIE
IARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETE
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAMNSVSVYRLDHTFEALQERKKRVLDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKELINFSKRRK
VAEITGEIQQYQNQPYCLRIEPEIRKFFENLNPMGKIPEKEFTDYLFNKSLEIEPRNCKQ
PPRFPRKTTYPLKSPGIRPNAGRHGSTSGTLRSHPLPLEKEPSKICFSRITEAEHESAVS
APTSPNTPSTPPVSASSEFSVFLDIDLNSSYGNNSIFAPVSLPQSKTFFSSWGSFPKLSD
EPQNPPPLPPRKKMDQDVSNAKGSLKSDDDPPAIPPRQPPPPKIQPRAPAYSPFEQPLHS
PPPPPPRDPLPDTPPPVPHRPPEHFINCPLNLQPPPVGRMHRDADWFREAGPGPSSPGTP
PSTPSPRVLRRCCVIGAAHNSPGHPPAPPVPPRQNSSPQLPKLPPKTYKRELSHPPLHRL
SLLENAEAPQ
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgccgccgcagccctacgagttcttcggcgaggagaacggcccgaaatggcgg
gggctcttcgtgcccgccctgcgcaaggttcagcaacaggttcaccccaacctttcggca
aaggaagattccctctactacattgaggagttgatacttcagctgctaaacaagctatgc
atcgcccagccacgcacagtccaagatgtagaggagcgtgttcagaagacgtttcctcat
cccatagacaaatgggccattgccgacgcacagtctgctatagagaaaaggaaaagaaga
aaccctctcctgctgcccgtggacaaaatacaccccttattgaaggaggtcctaggttac
aaagtagattaccacgtctctctgtatattgtggctgtcttagaatacatctcagctgac
attttaaagctggctggaaactacgttttcaatatacgacactttgagatctcccagcag
gacattaaagtatctatgtgtgctgataaggttttgatggatatgtttgatcaggatgac
attggcttggtttctctctgtgaagacgaaccttcttcttctggggagctcaattattat
gacctagtgagaaatgaaattgcagaagaaaggcagtatctccgggagctgaatctgata
ataaaagtatttcgggaagctttcctctctaacagaaagttgttcacacctaacgatatt
gatgtggtattcagcaacatttcagacattcacgagttgacagtgaagcttttgggattg
attgaggatactgttgaaatgactgatgagagcagtcctcatcctctggctggcagctgc
tttgaggatcttgctgaggaacaagcctttgatccatatgaaaccttatcccaggatatt
ctgtctccacaatttcatgagcattttaataacttaatggcaaaacctgctgttgctctt
tactttcagtctactgctgaaggttttaaagaagctgtacgatatgtcctcccacggctc
atgcttatcccagtctatcattgtttgcactactttgagttactgcagcaactgcaggaa
tgcagtgaagatgaggaggatcgggagtgcttgaaacaagccattactgctcttctgaat
ctccagtgcagcatggagcgcatctacagcaaacactccccaagacgtcggcctggggag
ccagtctgtcgcttctataaccggcaaataagaagcaagcacttggccatcaagaaaatg
aatgaaatccagaaaaatattgatggctgggaaggcaaagatattgggcagtgctgtaat
gaattcataatggaaggcaccttgacaaaaataggagctaaacatgaacgacacatcttt
ctctttgatggcttaatgatcagctgtaaaactaaccatggccagtcacggctccccggt
tacagcaacgcggagtatagactgaaggaaaagataatcatgagaaaaatacagattatt
gataaagatgacacatctgaatataaacacgcttttgaactggtgtctaaagatgaaaac
agtatactctttgctgccaagtctgctgaagagaagagtaattggatggctgctctgatt
tccctccagtatcggagtacactggataggatgctcgactcagtgttactgcaagaagaa
aatgagcagccactgagattgcccagcccaaacgtgtaccgctttgtagtagaagattct
gaggataacattgtttttgaggacaacttgcaaagcaggaatggaattcccatcatcaaa
ggaggaacggttgtgaaattaatcgagaggctaacgtaccatatgtatgcagatcccaat
tttgtacgtactttccttaccacataccgttccttttgcaagccccaggaactgctgagt
ttactgattgaaaggtttgaaatcccagagcctgaacctactgaagcagacaggctggca
atcgagaaaggggagcagcccatcagtgcagaccttaagcgatttcgcaaggaatacgtc
cagccagtgcaactcagaatattaaatgtttttcgtcattgggtggagcaccatttttat
gactttgaaagagacctggagttactagagagattggagacgtttatttcaagtgtaaga
ggaaagtccatgaagaagtgggtggaatcaatcgctaaaatcatcaagagaaagaaagca
caggccaatgggatcagtcacaacatcacctttgagagcccgcctccccccatcgagtgg
cacatctggcgcgtggggcacagcgagatgctggacctcatgactctgcaccccatcgaa
atcgctcggcagctgacgcttctcgagtctgatctgtacagggcagtgcagccttctgaa
ctcgtcggtagcgtttggactaaagaagataaggaaatcaactccccaaatctattgaaa
atgattcgccatactacaaatctcactctttggtttgaaaagtgcatagtggaaactgag
aactttgaagagcgagtggctgtgctgagcaggattatagaaatcctgcaagtgtttcaa
gatctgaacaatttcaatggtgttttggagatagtcagtgcaatgaactccgtgtcggtg
tacagactagatcacacattcgaggcactacaggaaaggaaaaaaagagttttggacgaa
gcagtagaactaagtcaagatcacttcaaaaaatacctagctaagctcaagtcaatcaat
ccaccttgtgtgcctttctttggaatatacctaacaaatattttgaagacagaagaaggg
aatcccgacttccttaaaagacaagggaaagaattaattaatttcagtaagaggaggaaa
gtggctgaaattacaggagaaattcagcagtatcaaaaccagccttactgtttacggata
gagccagaaattcggaaattctttgaaaatctcaatcctatggggaagatacctgagaaa
gagtttacagattatctgttcaacaagtcattagaaattgaacctcggaactgcaagcag
cctcctagatttcctaggaaaacaacataccccctgaagtctcctgggataaggcccaat
gctggcaggcacggctccacctctggcaccttgagaagtcacccactgccacttgaaaag
gagccgagtaagatatgtttcagtagaatcactgaggcggagcacgaatcagcagtgtct
gcaccaacctctcccaacacaccttccactcccccggtgtctgcttcgtcagagttcagc
gtatttttagacattgatctcaacagttcttatggtaacaacagcatcttcgctcccgtc
agtttgcctcagtcaaagacttttttcagctcgtggggtagctttcctaagctaagtgat
gagcctcaaaaccctcctccgcttcctcctcgaaaaaagatggatcaggatgtttctaat
gctaagggaagtctgaaatcggatgatgatcctccagcaattccacctcggcaaccgcca
cctccaaagatccagcctcgtgctcctgcttacagcccctttgagcagcctctgcacagc
cctcctcctcctccccctcgggaccctctccccgacactccgcctccggtacctcaccgg
cctcccgaacactttatcaactgccctctaaacctgcagccgccgccggtggggcgcatg
cacagagatgccgactggttccgggaggcaggcccaggccccagctctcctggcactcct
cccagcactccctctccgcgggtgctgcgccgctgctgcgtgatcggcgccgctcacaac
agcccgggccacccgcctgcaccccccgtcccacccaggcagaattcgagccctcagctc
ccaaagctgccaccaaagacttacaaaagggagctctcccacccccctttgcacagactg
tctttgctagagaatgcagaagctcctcaatga

DBGET integrated database retrieval system