KEGG   Gallus gallus (chicken): 423682Help
Entry
423682            CDS       T01006                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
gga  Gallus gallus (chicken)
Pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    423682 (PRKG1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     423682 (PRKG1)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   423682 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 742 aa AA seqDB search
MVIVAISRIPASPSGTKAFPLFLRFFRAPLLLPPPLPAAPRPVPGDVGPAAVSGAGRAAP
VPPPCERRGPTMSELEGDFTKLLLLKEERIRELERRLGEKDEEIQELRRRLHKCHSVLPA
PSPHIGPRTTRAQGISAEPQTYRSFHDLRQAFHKFTKAERSKELIKEAILDNDFMKNLEL
SQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGEL
AILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEI
LSKLADVLEETHYESGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLGKGDW
FGEKALQWEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEA
AFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSE
KQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVV
EAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEI
ILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAAN
LIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNF
DSFPEDNDEPPPDDNSGWDIDF
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggtaattgttgctatttccaggatcccagcctcgccgagtggcacaaaagcttttccc
ctttttctccgcttttttcgggccccgcttcttctccctccgcctctccctgccgctccc
cgcccggtgccgggcgatgtggggccggcggccgtgagcggggcgggcagagccgccccc
gtgccccctccatgcgagcggcgcggccccaccatgagcgagctggaaggggacttcacc
aagctgctgctgctcaaagaagagcgcatcagggaactggagcggcgcctgggagagaag
gacgaagagattcaggagctccgccgccgtctgcacaaatgccactcggtgctgccggcc
cccagcccgcacatcgggccccgcaccacgagggcgcagggcatctcggccgagccgcag
acctaccgctccttccacgacctccgccaggccttccacaagttcaccaaggccgagagg
tccaaggagctaataaaggaagcaatccttgacaatgacttcatgaagaatctggagctg
tctcagatccaggagattgtggattgtatgtatcctgtggagtatggcaaagacagctgt
atcatcaaggagggagatgtgggttccctggtgtacgtcatggaagatgggaaggttgaa
gtgacaaaagaaggcgtgaagctgtgcaccatgggaccgggcaaggtgttcggggagttg
gccatcctctacaactgcactcgaacagcaactgtcaaaactctcgtaaatgtgaaactt
tgggctattgatcggcaatgttttcaaacaataatgatgaggacaggcctcatcaagcat
actgagtatatggaatttttaaaaagtgttcccacattccagagccttcctgaggagata
ctcagtaagcttgcagatgtccttgaagagacacactatgaaagtggggagtatattatc
cgacagggtgctcgaggggacaccttctttataatcagcaaaggaaaggtgaacgtcact
cgtgaagattcccccagtgaggatccagtctttctccgtactttaggaaaaggagattgg
tttggagaaaaagcactgcaatgggaggatgtcagaactgccaacgtcattgcggctgaa
gcagtaacttgtctggtcatagacagagactccttcaaacatctgattggcggcctagat
gatgtttccaataaagcctatgaagatgcagaagcaaaagcaaaatatgaagccgaagct
gccttcttcgccaacctgaaactgtctgatttcaacatcattgacacccttggagtcgga
ggtttcggacgagttgaactggtccagttgaaaagtgaagagacgaagacgtttgcgatg
aagatcctgaagaaacgtcacatagtggacacaaggcagcaggagcacatccgctcggag
aagcagatcatgcagagcgctcactcagacttcatcgtgaggctctacaggacgttcaag
gacagcaagtacctgtacatgctgatggaagcctgtctaggtggagagctctggacaatt
ctcagggacagaggttcatttgaggattcaacaaccaggttttacacggcgtgcgtagtt
gaagcttttgcctatttgcattccaaaggaatcatttatagggacctcaagccagaaaac
ctcattctggatcatcgaggttatgccaaactggttgattttggctttgcaaagaaaata
ggatttggaaagaaaacatggactttttgtggaactccagagtacgtagcccccgagatc
atcctgaacaaaggtcacgatatttcagcagactactggtcactgggaatcctaatgtat
gaactcctgactggcagtccccctttctcaggcccagaccctatgaagacctataacata
atattaaggggaattgatatgattgaatttccaaagaagattgccaaaaatgctgctaat
ttaattaaaaaactatgcagggacaatccatcagaaagattagggaacttgaaaaatgga
gtgaaagacatccaaaagcacaaatggtttgaaggctttaactgggaagggttacgaaaa
gggacactgacacctcctataataccaagtgttgcatctccaacagacacaagcaatttc
gacagcttccctgaggacaatgatgaaccaccccctgatgacaactcaggatgggacata
gatttttaa

DBGET integrated database retrieval system