KEGG   Gallus gallus (chicken): 423734Help
Entry
423734            CDS       T01006                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     423734 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 2025 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLQLSVQDGSI
LKVTNKGLASYKDPDNPGRFSSVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PSGSSLKNIEKYLRSQNDLANIFNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLE
SKGAPKYSSGFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTSNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSVNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TGTTQKLKPPPSSLLPPTPISDQSPTSQKSSTSTSSNSPQSSSSQSSAPSFSRLPSNSQL
KGLFDGLSHIYATQEQSRKKGCPSYAPPKSMRRKPELSSTSKSNSHFYRRKEVRNRFIPR
ACPSGWGLSRGLAFKAIAHLKRTTLLKKHRILGRLKYKVTPQMGTPSTGKGSLADGRIKP
DQDDDTEIKLSIKQENTDVYLVGSKDTVTQEDLDVFKQARELSLEKIGCKNTGETSGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIRR
EKLISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEK
EEQEIFSTRSNSRQSPAKVQSKNKYLRSPENVAVVGERGQSTEQSKESSEEDGGDESQQS
SPPRLTKPQSLAMKRKRPFLLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERP
MPQLEPTCEMDGEDDDLKPVIRKAFEYQSVQQKQEKEEEQKKEEKDVHCLRSDDHCTDNT
EDVAVLEESTKDNLEPLKSKQGWPKGVKRGPSKWRQNKERKPGFKLNLYTPPETPMEPDY
QMLVEEQKEVAEDKPCPVPAVSEEEIKEPVEVLPPPDDEVKEIEPEPLHPPGEPYEKQED
DTVKAGEEERNVEDSEINSKDPEKDKPEEVFLQKEESMHLDDHDEEEEDDEEPSHNEDHD
ADDEDDSHMGSAEVEKEDLPAEAFKEMLETQQSFLDVNVQTGNSNQEDLMDCGVDLAADE
CESDQKEVATDSDPVPESDDDHTENNQDQKAGEELHSDFKGESNETMEIDSETVQAVQSL
TQEASEQEDTFQDCAETQEACRSLQNYAHTDQSPQMTTLDDCQQSDHSSPVSSVHSHPSQ
SVRSVNSPNVAPLENNYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSD
LGSIESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNIN
GSCSMMQQTSISSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPEAGN
ANIGLYERMGQSEFGPGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASL
STPLSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRSMTSSNIGISH
TQRLQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGCASQTVAMQGPTRTLTMQRGMNMS
VNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMM
GTQPYAQQPMQTAPHSNMMYSPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6078 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaacccactttatacggagtggattcttgaagctatacaaaaagtt
aaaaagcaaaagcaacggccatctgaagagagaatatgtcacgctgtttgtgcttcccat
ggattagataagaagactgtttcggaacagctgcaacttagtgttcaagatggttctatt
cttaaagttaccaacaaaggccttgcatcttacaaggacccagataatcctggacggttt
tcatctgttaaacctggcactattccgaaatctgttaaaggatctagaggagcttgtaat
gagcttcgtaatgtggattggaataaactgttgagaagagcaattgaagggcttcaagaa
ccaagtggctcctcactgaaaaacatagagaagtatttgagaagtcaaaatgacctagca
aatattttcaacaatcctgcctttcagcagagattgcgtctgggggccaaacgtgctgtg
aacaatggcagattactgaaggatggacctcagtacagagtgaattatggtggtttggaa
agcaaaggagctcctaaatattccagtggtttcccagcttctcttccacctgtcagcctt
ctaccccatgaaaaagaccagccacgagctgatcccatcccgatatgtagcttttgtttg
ggaacaaaagaatcaaatcgtgaaaagaaaccagaggagctgttgtcttgtgcagactgt
ggcagcagtggacatccatcatgtttgaagttctgtcctgagttaacatcaaatgtgaag
gccttaagatggcagtgtattgaatgcaagacatgcagtgcatgtaggatccaaggcaaa
aatgcagataacatgcttttttgcgactcctgtgatagagggttccacatggagtgctgt
gacccaccactttcccgaatgccaaaagggatgtggatttgccaggtctgtagaccaaag
aagaaagggagaaagctccttcatgagaaagctgcccaaataaggcgacgatatgcaaaa
cctatcggacgaccgaaaaataaactaaagcaacgaatgttgtctgtaaccagtgatgaa
ggatccgtgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggattcaagcagcagattgcct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaagggcttattgatggccttactaag
ttttttaccccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcttgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaacccccatc
tctgatcagagccccacttcgcaaaaatctagcacttccacttcttctaattctccccag
agttcttccagtcagtcaagtgcaccctcctttagtcgtcttcctagtaatagtcagcta
aagggactctttgatggactctctcatatctatgctactcaggaacagtctcgaaaaaag
ggatgcccaagctatgcaccacctaagagtatgcgtcgtaaaccagaattatcttctact
tcaaaatctaatagccatttttatagaaggaaggaggttagaaatagatttattcctcgt
gcctgtccctctggatggggtttgtctagagggcttgcttttaaagcaattgctcacctc
aagagaacaactttacttaaaaagcacaggattctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaacagggaaggggagcttggcagacggaagaattaaacct
gatcaggatgatgatactgaaatcaaactaagcatcaaacaagaaaacacagatgtatat
ctggtgggaagcaaggacacggttacgcaggaggatttggacgtatttaaacaggctcgg
gaactttccctggagaaaattgggtgtaaaaacactggtgaaacaagtgggcgataccct
tcagtgattgagtttggaaaatatgagatccagacgtggtactcttcaccttacccacag
gaatatgcaagactaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaacattttgttaaggcattcaaagaagtgtggctggtttcatcctccagccaatgaa
atctacagaagaaatgacctgtcagtgtttgaggttgatggaaacgtgagcaaaatttat
tgtcagaatctttgtttgttagctaagctctttctggaccacaaaaccttgtattatgat
gttgaaccattcctcttctatgttcttacaaaaaatgatgagaaaggatgccatttagtt
ggatatttctctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgatc
atgccccaataccaaaggcaaggatttggaaggtttctcattgatttcagctatttactt
tctagaagagagggtcaagcaggatcccctgaaaagccattatctgatctgggtcgcctc
tcttatttggcctactggaaaagtgtaatattagaatatcttaactgccaccatgaaaag
caaatcagcatcaaaggaatgagtcgagctactggaatgtgtccacatgatattgccaca
actctgcagcagcatagcatgatagataaaagagaagatagatttgtaattattagaagg
gaaaagctgatttcaagtcatatggagaaactgaaagcaaacccacgtattaatgaagtg
gatcctgaaagcttgagatggactcctctgctagtttctaacgctgcagtttctgaggaa
gagagagaagcagaaaaggaggctgagcgtctgatggagcaagctagctgctgggaaaag
gaagagcaagaaatattctccacaagatctaacagtaggcaatcacctgcaaaagtgcaa
tctaaaaataaatatttgcgatctccagaaaatgtggcagtggtgggggaacgagggcaa
tccacagagcaatctaaggagagcagcgaggaggatggcggggatgagagtcagcagagt
tcgcctccccggctgacaaagccacagtcactggccatgaaaagaaagagacctttccta
ctgaaaaagaaaagaggtcgtaaacgcagaaggattaatagcagtgttacaacagagact
atttctgaaactacagaagtgttgaatgagccatttgataactcagatgaagaacgtccc
atgccacagctggaacctacctgtgagatggatggggaagatgatgacttgaagcctgtg
attagaaaagcttttgagtatcagtctgtgcagcagaaacaggagaaagaggaagagcag
aaaaaagaggagaaagacgttcattgcctcaggagtgatgaccattgtacagataataca
gaggatgtagctgtattggaagaaagcactaaagacaatcttgaacctttaaagagtaag
cagggttggcccaaaggagttaagcgcggtccatctaaatggcggcaaaacaaagaaaga
aaacctggttttaagctgaatttatacactccacctgagactcctatggagcctgactac
cagatgctggtggaggaacaaaaggaagtagctgaagataagccttgtccagttcctgct
gtttcagaggaagagattaaagagcctgttgaagtattaccaccgccagatgatgaggta
aaagagatagaacctgaacctctgcatccacctggtgaaccctatgaaaaacaagaagat
gatacagtgaaagctggggaagaagaaaggaacgtagaagacagtgaaatcaattcaaaa
gatccagaaaaagacaaaccagaagaggtttttctgcaaaaagaagagtccatgcacttg
gatgatcatgatgaggaagaggaagatgatgaagaaccttctcacaatgaagatcatgat
gcagatgatgaagatgatagccacatgggttcagcagaagtggagaaagaggatttgcct
gccgaagctttcaaagaaatgctggaaacacagcaatcttttttagacgtaaatgttcag
actggtaattcaaatcaggaggacttgatggattgtggtgttgaccttgcagctgatgag
tgtgagagtgaccagaaagaagtagctacagattcagacccggtgccggaatctgatgat
gatcatactgaaaacaaccaggaccaaaaagctggtgaagaattacattccgatttcaag
ggagagagtaacgagactatggagattgattctgagacggttcaagcagtacagtctcta
actcaagaagcaagtgaacaggaagatacctttcaggattgtgcagagactcaggaggcc
tgtagaagtttgcaaaactatgcccatacagaccaaagcccccagatgaccacgctggat
gattgtcagcagtccgaccacagcagcccagtttcctccgtgcactctcatcccagccag
tcagttcgttctgttaatagtccaaatgttgctccattagagaacaactacgctcagatc
agcccagatcaaagtgccatttctgtgccatctctacagaacatggagactagcccaatg
atggatgttccctcagtttctgatcattcacaacaagttgtggatagtggctttagtgat
ttaggaagcattgagagcacaacagaaaactatgaaaacccaagcagttatgactctaca
atgggtagtagtatctgcggaaacaactcttcacaaaatagttgctcgtacagtagcctt
acatctagcaacctaacacagagtagctgtgcagtgacacagcagatgtctaacattaat
ggaagctgtagtatgatgcagcaaacaagcatcagttctcctcccacttgtaacgtgaaa
tctccccaaggttgtgttgttgaaaggcctccaagcagcaaccagcagttatctcagtgc
agcatggccgctaattttacaccacctatgcagttaactgaaatccccgaggctggcaat
gccaacattggcttatatgaaagaatgggtcagagcgaatttggaccaggacactactca
cagccatcggccaccttcagccttgccaaactgcagcagttaactaacacgcttatggat
cattctttgccttacagccattcagctgctgtaacttcctatgcaaacagtgcctctttg
tccacccccctaagtaatacagggcttgttcagctttctcagtctccacatgctgttcct
ggaggaccacaagcacaggctaccatgactcctccccccaaccttactcctcctcccatg
aatttgccacctccccttttgcagcgcagcatgacttcatcgaatattggaatatcccac
acccaaagactgcagactcagatggccagcaaaggtcatgtttctgtaagaaccaaatct
acacctctgccacctgctgcagcggcccatcagccccagatttacggctgtgcatcacaa
actgtggccatgcagggacccacacggaccttaacaatgcagcgtggtatgaacatgagt
gtaaacttgatgccagccccagcttacaatgtcaattcagtgaacatgaatatgaatacc
cttaatgctatgaatggttatagtatgtcccagccgatgatgaatagtggatatcacagt
aatcatgggtatatgaatcaaactccccagtaccctatgcagatgcagatggggatgatg
ggaactcagccatatgcacagcagccaatgcagacagcaccccacagtaacatgatgtac
agtcctccggggcatcatggctacatgaacacaggcatgtctaaacagtctcttaatggc
tcctacatgagaaggtag

DBGET integrated database retrieval system