KEGG   Gallus gallus (chicken): 423851Help
Entry
423851            CDS       T01006                                 

Gene name
MGEA5
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
6
AA seq 661 aa AA seqDB search
MVQKEGQAALEEPQGSPNPAGVPGAPLEPPGAATGPVPGGEETDTETETALGSRRFLCGV
VEGFYGRPWVMEQRKELFRRLQKWGLNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLIS
AAREHEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAAD
KEVFSSFAHAQVSITNEIYQYLGEPDTFLFCPTEYCGTFCYPNVAQSPYLRTVGEKLLPG
IDVLWTGPKVVSKDIPVESIEEVSKIIRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELI
PRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDTEDSTVSIQIKLENEGS
DEDIETDVLYSPQMALKLALTEWLQEFGVPQQYSSRQVAHSGAKTAVGDVGPLVAPSSLN
AATVVTTVYQEPIMSQGAALSSESPALVKEEEKKQCDEEPMDMVVEKQDDADKNANQILT
DIAEAKMTEELKPMDTDKESIAESKSPEMSMQEDSGSDIAPMQTDEQINKEQFLPGPNEK
PLYAVEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDAEKIE
EWRNRAAKFEEMCSLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLAFAA
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggaggggcaggcggccttggaggagccccagggcagccccaacccggcc
ggagtgcccggagctcccctggagccgccgggtgccgccacggggcccgtcccgggaggc
gaggaaaccgacacggagacggagacggcgctgggctcccgccgcttcctctgcggcgtg
gtggaaggcttttatggaagaccttgggttatggagcagaggaaagaactttttagaagg
cttcagaagtggggactgaatacatacctgtatgctccaaaggatgactacaagcacagg
atgttctggcgggaaatgtactctgtggaagaagcagagcagctaatgactctaatatca
gctgcacgtgaacatgaaatagagttcatctatgcaatctcacctggacttgacatcact
ttctcaaatcccaaagaagtatccacgttgaaacgcaagctggatcaggtttcccagttt
ggctgcagatcttttgccctgctgtttgacgatattgaccacaacatgtgtgcagcagac
aaagaagtgtttagttcctttgctcatgctcaagtatccataacaaatgaaatttaccaa
tatctaggagaaccagacacattccttttctgtcctacagaatactgtggaactttctgt
tacccaaatgttgctcagtctccatatttacgaactgtaggagaaaaactgcttcctggc
atcgatgtgttatggacaggtccgaaagttgtatccaaagacattccagtagagtccatt
gaagaagtttctaagatcatcaggagagcaccagttatttgggacaacattcacgctaat
gattatgatcaaaagaggctttttcttggcccttacaaaggtcggtcaactgagctcatc
cctcgactaaagggagttctgaccaatccaaactgtgaatttgaagccaattatgttgct
attcacacacttgcaacctggtacaagtctaacatgaatggagtgagaaaagatgttgtg
atgactgatactgaagacagtacagtttctatccagatcaaactagaaaatgaagggagc
gatgaagatattgaaacagatgttctctacagcccacaaatggccctgaaattagcctta
actgaatggcttcaggagtttggagtacctcagcaatacagcagtaggcaagtggcccac
agcggagctaaaactgctgtaggggacgtagggcctctggtggcaccgtcgtctttaaat
gcagcaactgtggttaccacagtttaccaggaacccatcatgagtcaaggcgcagcactg
agcagcgagtcaccagctttggtaaaggaggaagagaagaagcaatgtgatgaagagcca
atggacatggttgtggaaaaacaagatgatgcggacaagaatgctaatcagatattgaca
gatattgctgaagcaaagatgacagaagagttaaagccaatggatactgataaggagagc
atagctgaatcaaagtccccagagatgtctatgcaggaggactctggtagtgatattgcc
cctatgcagactgatgaacaaattaacaaagaacaatttctgcctgggccaaatgaaaaa
cctctctatgcagtagaaccagtgacattagaggacttgcagcttcttgctgacttgttt
tatctcccatatgaacatgggcccaaaggtgcacagatgttgagagaattccagtggctt
agagcaaatagcagtgttgtcagtgttaactgcaaaggaaaggatgctgaaaaaatagaa
gaatggcgtaaccgagcagctaagtttgaagagatgtgcagcttggtgatgggaatgttc
actcgcctctccaattgtgccaacagaacaatcctttatgatatgtactcctacgtctgg
gatatcaagagtataatgtcaatggtgaaatcttttgtgcaatggttagcgtttgctgcc
tattga

DBGET integrated database retrieval system