KEGG   Gallus gallus (chicken): 423901Help
Entry
423901            CDS       T01006                                 

Gene name
CASP7
Definition
(RefSeq) caspase 7, apoptosis-related cysteine peptidase
  KO
K04397  
caspase 7 [EC:3.4.22.60]
Organism
gga  Gallus gallus (chicken)
Pathway
Apoptosis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    423901 (CASP7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     423901 (CASP7)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C14: caspase family
   423901 (CASP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 309 aa AA seqDB search
MSGDQHADRSSGEKSNGDQDDTVDAKPDRSSRLSLFAKKKKNGEEEQPKSSLSNQYRIVT
PTFQYNMNYKKVGKCIIINNKNFEDKTGMGTRNGTDKDAGDLSKSFRSLGFDVYTYNDRS
CEDMQTLLKQAAEENHSDAACFACILLSHGEEGLIYGTDGPMAIKHLTTLFRGDKCKTLI
GKPKLFFIQACRGSEFDEGIQTDSGPANDTLETDANPRYKIPVEADFLFAYSTVPGYYSW
RNPGRGSWFVQSLCSVLNEHGKQLEIMQILTRVNYVVATNFESQSDDPRFSEKKQIPCVV
SMLTKELYF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagatcagcatgctgatcgttcctctggagagaaaagcaatggagatcaagat
gatacagttgatgcaaagccagacagaagtagcagactctcactttttgccaaaaaaaag
aagaatggagaagaagaacaaccgaagtcctcactcagtaaccagtaccgaattgttaca
cccacattccagtataatatgaactacaagaaggttggaaaatgtataattataaacaac
aaaaattttgaagacaaaacaggaatgggtacacgcaatggaactgataaagatgctgga
gatctgtctaagagtttcagaagcttaggttttgatgtttacacatacaatgaccgaagc
tgtgaggatatgcaaacactactgaaacaagctgctgaggagaatcacagtgatgctgct
tgttttgcctgtatccttctaagccatggggaagaaggcctcatttatggcaccgatgga
cccatggctatcaaacacctgactacactcttcagaggagacaaatgtaaaaccctcata
ggcaaacccaaactgtttttcattcaggcatgccgaggctctgagtttgatgaaggtata
caaactgactctggaccggcgaatgacactctggaaacagatgccaatcctagatacaaa
atcccagtagaagcagattttctgtttgcatattccacagtgccaggttattattcctgg
aggaatcctggaagaggctcttggtttgtgcagtctctgtgctctgtgctaaatgaacac
ggaaaacaacttgagatcatgcagatcctcacacgggtcaactatgtggttgccacgaat
tttgaatcacagtctgatgatccacgcttcagtgagaagaagcagattccttgcgtagtc
tctatgctcactaaggaactttacttctga

DBGET integrated database retrieval system