KEGG   Gallus gallus (chicken): 423976Help
Entry
423976            CDS       T01006                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
gga  Gallus gallus (chicken)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    423976 (ALDH18A1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    423976 (ALDH18A1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     423976 (ALDH18A1)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     423976 (ALDH18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 802 aa AA seqDB search
MSCQAALNPLVRSPGWCFVLSPHAIAAVSRFYLPHHTQSLRNESIRCWSNIPFITMPLSR
AHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSMLQNQGREMMIV
TSGAVAFGKQRLRHEILLSQSVRQALHSGQSQLKDMAIPVLEARACAAAGQSGLMALYEA
MFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDL
QGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSV
TFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSE
VKPAGPTVEQQGEMSRAGGRTLAALQPEQRAEIIYRLADLLTDQREEILLANKKDLEEAE
NKGRLALPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRIIRRTRIAKDLELEQVTVPI
GVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAAYSNQILHHLTQEALSIHGVKDAV
QLVNTREEVEDLCRLDKLIDLIIPRGSSQLVRNIQKAAKGIPVMGHSEGICHVYVDTDAS
VEKVTRIIRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASY
LTFSPSEVKSLRTEYGDLECCIEVVDSVQEAVEHIHKYGSSHTDVIITENEKTAEFFLQH
VDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGIEGLLTTKWLLRGDNHVVSD
FSEHGSMKYLHENLPLPHRNTS
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtcaagctgctctgaaccctcttgtccgttcccctggatggtgctttgtgtta
tcaccacatgccatcgcagccgtttcccgtttctatctccctcaccatacccagagttta
aggaatgaatccatccgttgttggagcaacatcccatttatcaccatgccactcagccgt
gcacatggcaaatcatttgcacaccgcagtgagctgaagcatgcaaagcggattgtagtg
aagctgggcagtgctgttgtgacaagaggagatgagtgtggtttagcccttggcaggctg
gcatctattgtggagcaggtgtcaatgctgcagaatcagggccgagagatgatgattgtc
accagtggtgctgtagcttttggaaaacagcggttgcgtcatgagatcttgctttctcag
agtgtgaggcaagcacttcattcaggccaaagtcagctaaaagatatggctattccagtc
ttggaggcccgagcctgtgcagcagctggccagagtggactgatggccctgtatgaagcc
atgtttacacagtacagcatctgtgcagctcaaattttagttaccaatctggatttccat
gatgaacagaaacgtcggaacttaaatggaacactacatgagcttttaagaatgaatatt
gtccccataattaacactaatgatgctgttgttccacctccagaaccgaacagtgatcta
cagggggtaaatgtgattagtgtgaaggataatgacagtttggcagcacgtctggctgtc
gaaatgaagaccgatctccttattgttctttctgacgtagaaggactctttgacagccct
ccaggatctgatgatgctaagctcattgacatattctacccaggagaccaacagtctgtg
acatttggaaccaaatctcgagtgggaatgggaggcatggaagccaaggtgaaagcagct
ctgtgggccctccaaggaggcacttctgtagtgattgcaaatggaactcacccaaagatc
tctggtcacgtcatcacagatattgtggaagggaaaaaggttggaacttttttttcagag
gtaaagcctgcaggccctacagtggagcagcaaggtgaaatgtctcgagctggtggcagg
acgctggcagctctgcagcctgagcagagagcggagattatttatcgtcttgctgactta
ctaactgatcaaagagaagaaattctcttggcaaacaagaaggacttagaagaagcagaa
aataaagggagactggctcttcctttgttgaaacgtctaagtctgtctacatcaaagctg
aacagcttggctattggactacgccagattgcagcatcctcacaggacagtgtcggccgc
ataattcggagaacaagaatagcgaaagacctggaattggagcaggtgacggtgcctatt
ggggttcttctcgtgatttttgagtcccgtcctgactgtctcccacaggtgtctgctttg
gccattgctagtggaaatggtttgctacttaaaggaggaaaagaggcagcttatagcaat
caaatccttcatcatctgactcaagaagcactttcaattcatggagtcaaagatgcagtg
caactggtgaatacaagagaggaagtagaagatctctgccgtttggataagctgatagat
cttatcattccacgtggctcatcccagctagtcagaaatatacagaaagctgccaaggga
atccctgtgatgggacacagcgaaggaatctgtcatgtgtatgtggacacagatgccagt
gttgaaaaggtcacgcgaataatcagagactcaaagtgtgaatatcctgctgcctgcaat
gctctggaaacactcttaattcatcgagacttgctgagaaccccgttgtttgatcagatc
atagacatgttgagagtagaacaggtgaagattcatgctggcccaaaatttgcctcttac
ttaacattcagcccctcagaagtgaaatctctccgcactgaatatggggacctggagtgc
tgcattgaggttgtggacagtgtccaagaggctgttgaacatatccacaaatatggaagt
tctcatacagatgttatcatcacagaaaatgagaaaacagcagagttcttcctccagcat
gtggacagcgcttgtgttttctggaatgccagcacccgattctctgacggatatagattt
ggacttggtgctgaagttggaattagtacttctcgtatccatgcacgtggaccagtagga
attgaaggactcttaactacaaagtggttgctgagaggggacaatcatgttgtttctgac
ttttcagagcatggcagcatgaaatatcttcatgagaacctccctctccctcacagaaat
accagctaa

DBGET integrated database retrieval system