KEGG   Gallus gallus (chicken): 423976Help
Entry
423976            CDS       T01006                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
gga  Gallus gallus (chicken)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gga01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gga00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
6
AA seq 802 aa AA seqDB search
MSCQAALNPLVRSPGWCFVLSPHAIAAVSRFYLPHHTQSLRNESIRCWSNIPFITMPLSR
AHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSMLQNQGREMMIV
TSGAVAFGKQRLRHEILLSQSVRQALHSGQSQLKDMAIPVLEARACAAAGQSGLMALYEA
MFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDAVVPPPEPNSDL
QGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSV
TFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIVEGKKVGTFFSE
VKPAGPTVEQQGEMSRAGGRTLAALQPEQRAEIIYRLADLLTDQREEILLANKKDLEEAE
NKGRLALPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRIIRRTRIAKDLELEQVTVPI
GVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAAYSNQILHHLTQEALSIHGVKDAV
QLVNTREEVEDLCRLDKLIDLIIPRGSSQLVRNIQKAAKGIPVMGHSEGICHVYVDTDAS
VEKVTRIIRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASY
LTFSPSEVKSLRTEYGDLECCIEVVDSVQEAVEHIHKYGSSHTDVIITENEKTAEFFLQH
VDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGIEGLLTTKWLLRGDNHVVSD
FSEHGSMKYLHENLPLPHRNTS
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtcaagctgctctgaaccctcttgtccgttcccctggatggtgctttgtgtta
tcaccacatgccatcgcagccgtttcccgtttctatctccctcaccatacccagagttta
aggaatgaatccatccgttgttggagcaacatcccatttatcaccatgccactcagccgt
gcacatggcaaatcatttgcacaccgcagtgagctgaagcatgcaaagcggattgtagtg
aagctgggcagtgctgttgtgacaagaggagatgagtgtggtttagcccttggcaggctg
gcatctattgtggagcaggtgtcaatgctgcagaatcagggccgagagatgatgattgtc
accagtggtgctgtagcttttggaaaacagcggttgcgtcatgagatcttgctttctcag
agtgtgaggcaagcacttcattcaggccaaagtcagctaaaagatatggctattccagtc
ttggaggcccgagcctgtgcagcagctggccagagtggactgatggccctgtatgaagcc
atgtttacacagtacagcatctgtgcagctcaaattttagttaccaatctggatttccat
gatgaacagaaacgtcggaacttaaatggaacactacatgagcttttaagaatgaatatt
gtccccataattaacactaatgatgctgttgttccacctccagaaccgaacagtgatcta
cagggggtaaatgtgattagtgtgaaggataatgacagtttggcagcacgtctggctgtc
gaaatgaagaccgatctccttattgttctttctgacgtagaaggactctttgacagccct
ccaggatctgatgatgctaagctcattgacatattctacccaggagaccaacagtctgtg
acatttggaaccaaatctcgagtgggaatgggaggcatggaagccaaggtgaaagcagct
ctgtgggccctccaaggaggcacttctgtagtgattgcaaatggaactcacccaaagatc
tctggtcacgtcatcacagatattgtggaagggaaaaaggttggaacttttttttcagag
gtaaagcctgcaggccctacagtggagcagcaaggtgaaatgtctcgagctggtggcagg
acgctggcagctctgcagcctgagcagagagcggagattatttatcgtcttgctgactta
ctaactgatcaaagagaagaaattctcttggcaaacaagaaggacttagaagaagcagaa
aataaagggagactggctcttcctttgttgaaacgtctaagtctgtctacatcaaagctg
aacagcttggctattggactacgccagattgcagcatcctcacaggacagtgtcggccgc
ataattcggagaacaagaatagcgaaagacctggaattggagcaggtgacggtgcctatt
ggggttcttctcgtgatttttgagtcccgtcctgactgtctcccacaggtgtctgctttg
gccattgctagtggaaatggtttgctacttaaaggaggaaaagaggcagcttatagcaat
caaatccttcatcatctgactcaagaagcactttcaattcatggagtcaaagatgcagtg
caactggtgaatacaagagaggaagtagaagatctctgccgtttggataagctgatagat
cttatcattccacgtggctcatcccagctagtcagaaatatacagaaagctgccaaggga
atccctgtgatgggacacagcgaaggaatctgtcatgtgtatgtggacacagatgccagt
gttgaaaaggtcacgcgaataatcagagactcaaagtgtgaatatcctgctgcctgcaat
gctctggaaacactcttaattcatcgagacttgctgagaaccccgttgtttgatcagatc
atagacatgttgagagtagaacaggtgaagattcatgctggcccaaaatttgcctcttac
ttaacattcagcccctcagaagtgaaatctctccgcactgaatatggggacctggagtgc
tgcattgaggttgtggacagtgtccaagaggctgttgaacatatccacaaatatggaagt
tctcatacagatgttatcatcacagaaaatgagaaaacagcagagttcttcctccagcat
gtggacagcgcttgtgttttctggaatgccagcacccgattctctgacggatatagattt
ggacttggtgctgaagttggaattagtacttctcgtatccatgcacgtggaccagtagga
attgaaggactcttaactacaaagtggttgctgagaggggacaatcatgttgtttctgac
ttttcagagcatggcagcatgaaatatcttcatgagaacctccctctccctcacagaaat
accagctaa

DBGET integrated database retrieval system