KEGG   Gallus gallus (chicken): 423979Help
Entry
423979            CDS       T01006                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
gga  Gallus gallus (chicken)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gga01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gga00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:gga00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:gga00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 385 aa AA seqDB search
MAARVLMAPRRLKPFNRLQVILQHLKTCKHTDSAADVLLQKQGGAGIITLNRPKVLNALS
FKMIQQIYPQIKAWEQDPETFLIIIKGTGEKAFCAGGDVRAIADAGKAGDTMTRDYFREE
YRLDNAIGTCKKPYVALIDGITMGGGVGLSVHGHFRVATEKTVFAMPETAIGLFPDVGGG
YFLPRLSGKIGHLLALTGFRLKGRDVLKAGIATHFVESGKLPELEKDLIALKSPSKENIA
DLLNSYHMQTKIDQEKEFVLDEHMERINSIFSANSMEEIVQKLKQDGSPFATKQLEAINK
MSPTSLKLTLRQLREGATMSLQDVFTMEYRLSQACMRGHDFYEGVRAVLIDKDQSPRWKP
AALEEVSDEFVDNCFKPLGNNDLKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacgcgtgctgatggcgccgcgcagactgaagccctttaacagactgcaagta
atattacagcatttgaaaacgtgtaagcataccgattctgcagctgatgttctgttgcaa
aagcaaggaggcgcaggaataataaccttgaacagacccaaggttctcaatgcactaagt
ttcaagatgatccaacaaatttatccacagataaaggcttgggagcaagatcctgaaact
tttctaataattataaagggaaccggagaaaaagctttttgtgctggcggcgatgttaga
gctattgcagatgcaggaaaagctggagatacaatgacacgagattacttcagagaggaa
tatagactggacaatgccattggcacttgcaagaagccatatgttgcccttattgatggc
attacaatgggagggggagttgggctctcggtgcacggacatttccgagttgcgaccgaa
aagacagtttttgcaatgccagaaacagcaataggccttttccctgatgtaggtggaggt
tatttcctgccaaggctttcaggaaagattggccatctacttgcactgacaggattcagg
ctgaaaggaagagatgtgctaaaagccggcatcgccacgcatttcgtggaatcaggaaag
ctacctgagttagagaaagacctgatagcattgaaatctccttcaaaagaaaatattgca
gacttgctgaactcttaccacatgcagaccaaaattgaccaagaaaaggagtttgtcctt
gacgaacatatggagaggattaacagtattttttcagcaaatagcatggaagaaattgtt
caaaagttaaagcaagatggttctccttttgccacgaagcagctagaggctattaataag
atgtcgcctacatccctaaagctgactctcagacaactcagagaaggtgctaccatgagt
ttacaagacgtgttcacgatggagtacagactgagccaggcatgcatgagaggccatgac
ttctatgaaggggttcgagcagtgctgattgacaaggaccagtcgccccgctggaagcct
gctgctctggaagaagtcagcgatgaattcgtggacaattgttttaagcctctgggaaac
aacgatctcaagttgtaa

DBGET integrated database retrieval system