KEGG   Gallus gallus (chicken): 423979Help
Entry
423979            CDS       T01006                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00280  Valine, leucine and isoleucine degradation
gga00410  beta-Alanine metabolism
gga00640  Propanoate metabolism
gga01100  Metabolic pathways
gga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    423979 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    423979 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    423979 (HIBCH)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     423979 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 423979
NCBI-ProteinID: NP_001026414
CGNC: 1646
Ensembl: ENSGALG00000043307
UniProt: Q5ZJ60
Position
7
AA seq 385 aa AA seqDB search
MAARVLMAPRRLKPFNRLQVILQHLKTCKHTDSAADVLLQKQGGAGIITLNRPKVLNALS
FKMIQQIYPQIKAWEQDPETFLIIIKGTGEKAFCAGGDVRAIADAGKAGDTMTRDYFREE
YRLDNAIGTCKKPYVALIDGITMGGGVGLSVHGHFRVATEKTVFAMPETAIGLFPDVGGG
YFLPRLSGKIGHLLALTGFRLKGRDVLKAGIATHFVESGKLPELEKDLIALKSPSKENIA
DLLNSYHMQTKIDQEKEFVLDEHMERINSIFSANSMEEIVQKLKQDGSPFATKQLEAINK
MSPTSLKLTLRQLREGATMSLQDVFTMEYRLSQACMRGHDFYEGVRAVLIDKDQSPRWKP
AALEEVSDEFVDNCFKPLGNNDLKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacgcgtgctgatggcgccgcgcagactgaagccctttaacagactgcaagta
atattacagcatttgaaaacgtgtaagcataccgattctgcagctgatgttctgttgcaa
aagcaaggaggcgcaggaataataaccttgaacagacccaaggttctcaatgcactaagt
ttcaagatgatccaacaaatttatccacagataaaggcttgggagcaagatcctgaaact
tttctaataattataaagggaaccggagaaaaagctttttgtgctggcggcgatgttaga
gctattgcagatgcaggaaaagctggagatacaatgacacgagattacttcagagaggaa
tatagactggacaatgccattggcacttgcaagaagccatatgttgcccttattgatggc
attacaatgggagggggagttgggctctcggtgcacggacatttccgagttgcgaccgaa
aagacagtttttgcaatgccagaaacagcaataggccttttccctgatgtaggtggaggt
tatttcctgccaaggctttcaggaaagattggccatctacttgcactgacaggattcagg
ctgaaaggaagagatgtgctaaaagccggcatcgccacgcatttcgtggaatcaggaaag
ctacctgagttagagaaagacctgatagcattgaaatctccttcaaaagaaaatattgca
gacttgctgaactcttaccacatgcagaccaaaattgaccaagaaaaggagtttgtcctt
gacgaacatatggagaggattaacagtattttttcagcaaatagcatggaagaaattgtt
caaaagttaaagcaagatggttctccttttgccacgaagcagctagaggctattaataag
atgtcgcctacatccctaaagctgactctcagacaactcagagaaggtgctaccatgagt
ttacaagacgtgttcacgatggagtacagactgagccaggcatgcatgagaggccatgac
ttctatgaaggggttcgagcagtgctgattgacaaggaccagtcgccccgctggaagcct
gctgctctggaagaagtcagcgatgaattcgtggacaattgttttaagcctctgggaaac
aacgatctcaagttgtaa

DBGET integrated database retrieval system