KEGG   Gallus gallus (chicken): 423979Help
Entry
423979            CDS       T01006                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
gga  Gallus gallus (chicken)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    423979 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    423979 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    423979 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    423979 (HIBCH)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     423979 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 385 aa AA seqDB search
MAARVLMAPRRLKPFNRLQVILQHLKTCKHTDSAADVLLQKQGGAGIITLNRPKVLNALS
FKMIQQIYPQIKAWEQDPETFLIIIKGTGEKAFCAGGDVRAIADAGKAGDTMTRDYFREE
YRLDNAIGTCKKPYVALIDGITMGGGVGLSVHGHFRVATEKTVFAMPETAIGLFPDVGGG
YFLPRLSGKIGHLLALTGFRLKGRDVLKAGIATHFVESGKLPELEKDLIALKSPSKENIA
DLLNSYHMQTKIDQEKEFVLDEHMERINSIFSANSMEEIVQKLKQDGSPFATKQLEAINK
MSPTSLKLTLRQLREGATMSLQDVFTMEYRLSQACMRGHDFYEGVRAVLIDKDQSPRWKP
AALEEVSDEFVDNCFKPLGNNDLKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacgcgtgctgatggcgccgcgcagactgaagccctttaacagactgcaagta
atattacagcatttgaaaacgtgtaagcataccgattctgcagctgatgttctgttgcaa
aagcaaggaggcgcaggaataataaccttgaacagacccaaggttctcaatgcactaagt
ttcaagatgatccaacaaatttatccacagataaaggcttgggagcaagatcctgaaact
tttctaataattataaagggaaccggagaaaaagctttttgtgctggcggcgatgttaga
gctattgcagatgcaggaaaagctggagatacaatgacacgagattacttcagagaggaa
tatagactggacaatgccattggcacttgcaagaagccatatgttgcccttattgatggc
attacaatgggagggggagttgggctctcggtgcacggacatttccgagttgcgaccgaa
aagacagtttttgcaatgccagaaacagcaataggccttttccctgatgtaggtggaggt
tatttcctgccaaggctttcaggaaagattggccatctacttgcactgacaggattcagg
ctgaaaggaagagatgtgctaaaagccggcatcgccacgcatttcgtggaatcaggaaag
ctacctgagttagagaaagacctgatagcattgaaatctccttcaaaagaaaatattgca
gacttgctgaactcttaccacatgcagaccaaaattgaccaagaaaaggagtttgtcctt
gacgaacatatggagaggattaacagtattttttcagcaaatagcatggaagaaattgtt
caaaagttaaagcaagatggttctccttttgccacgaagcagctagaggctattaataag
atgtcgcctacatccctaaagctgactctcagacaactcagagaaggtgctaccatgagt
ttacaagacgtgttcacgatggagtacagactgagccaggcatgcatgagaggccatgac
ttctatgaaggggttcgagcagtgctgattgacaaggaccagtcgccccgctggaagcct
gctgctctggaagaagtcagcgatgaattcgtggacaattgttttaagcctctgggaaac
aacgatctcaagttgtaa

DBGET integrated database retrieval system