KEGG   Gallus gallus (chicken): 424028Help
Entry
424028            CDS       T01006                                 

Gene name
UGT1A1, UGT1A10, UGT1A6, UGT1A7, UGT1A8, UGT1A9
Definition
UDP glucuronosyltransferase 1 family, polypeptide A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    424028 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    424028 (UGT1A1)
   00500 Starch and sucrose metabolism
    424028 (UGT1A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    424028 (UGT1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    424028 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    424028 (UGT1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    424028 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    424028 (UGT1A1)
   00983 Drug metabolism - other enzymes
    424028 (UGT1A1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     424028 (UGT1A1)
Glycosyltransferases [BR:gga01003]
 Others
  Hydrophobic molecule
   424028 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
7
AA seq 876 aa AA seqDB search
MEEQSTSHSLLLSGSLHPHKALPTFYRREMASSHPGFHFLASWAVILLLLRIFSEGGKLL
VIPIDGSHWLSMRLVVEQLRHRGHEIVVVAPEINLRIGASMHYSMKTYSVSYTREFVEAE
FKKLGYKSFTPQTFLEKFSKITNITTMFFDSCKRLLSNKELMKYLEESMFDGVLMDPFFP
CGQIVAEHLSIPSVYLVRGLPCSLDFHATLCPNPPSYIPRFFTHYTDRMGFFQRLGNLLV
SLSSTLTCSFLYSPYDHLIKEFLQQEATLLELLSHASIWLMKYDFVFEYPRPVMPNMVLI
GGITCTQEKQISKHRLLKEHRASAIASVLPGLFFLCSSPHVSVGMALVLPSHPQVSVSLL
LLLSVLSLAAGGKLLVVSVDGSPWFSVLEMLEVLKQKGHEIVVVAPEANLNVKPSESFIL
KTYPASFTQEEMDDNFQAFLKDAFEEGSFLEQFHRLQEKVKRLFDVGFISCAWLLKNKEL
IRYLEESNFDALFTDPVFPCGAILAEHLSIPSVYFMRGMPCGLDFEATQCPNPPSYIPRA
FTDHTDHMNFLQRVKNVIFDTSNLFLCDFIFKPYEKLASEFLQRDVTVIDLLRKASVWLL
RYDFVLDYPRPLMPNIIVVGGINCAHKQLPQEFEAIVNASGEHGIVVFSLGSMVSEIPMK
KAMEIADALGSVPQTVLWRYTGEVPPNLPKNVKLVKWLPQNDLLAHPKTRAFITHGGSHG
VYEGICNAVPMVLMPLFGDQMDNAKRVESRGAGLTLNILEMTSKDISDALKAVINDKKYK
ENIQRLSDLHLDRPIHPLDLAVHWVEFVMRHKGAPHLRPAAHDLNWIQYHSLDVFAFLLA
VVLLSLFISVKCCMFCCRRCCFKKGRKSKSGKSKTH
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcaaagtacaagtcattctttgttgctttcgggatctctgcatccacataaa
gcattgccgacattctacagaagggaaatggcctcttcacatccaggatttcattttctt
gcctcctgggctgtgattctcctgctcctgaggatcttttctgaaggtgggaagcttttg
gttatccctattgatggcagtcactggcttagcatgcgcctggttgtggagcagctcaga
catagaggacatgaaattgtggttgttgctccagagataaatttgcgaataggtgcgtcg
atgcattatagcatgaaaacatactctgtgtcttacaccagagagtttgtggaggcagaa
tttaaaaagcttggctataagagtttcacacctcaaactttcttggaaaaattctcaaaa
ataacgaatattacaacgatgttttttgattcctgcaaaaggcttctttctaacaaagag
ctgatgaaataccttgaagaaagcatgtttgatggtgtccttatggatcctttttttccc
tgtggacagatagtggctgaacatctctccataccttctgtgtacctcgtacggggactg
ccgtgcagcctggacttccatgctaccctctgcccaaatcctccctcctacattcccagg
ttcttcacgcactacacagatcgtatggggttcttccagcgcctgggcaacctcctagtt
agcttgagcagtaccctaacctgtagctttctttattcaccgtatgatcatttgatcaaa
gaattccttcaacaagaggcaacactgcttgaacttttaagccatgcatctatttggctt
atgaaatacgactttgtgtttgagtatccgaggcctgtgatgcctaacatggtcttgatc
ggaggcataacctgcactcaggaaaaacagatatcaaagcacagattgctgaaagagcac
agggccagtgctattgcttcagtgctgcctggacttttcttcctgtgcagctctccccac
gtttccgtaggaatggccctggtccttccttctcatccacaagtctcggtgtcgctgctt
ctgctgctgtctgtgctgagcttggctgcaggtgggaagctgctggtggtgtctgtggat
gggagtccctggttcagcgtgctggaaatgttagaagttctgaagcagaaaggacatgaa
atagtcgttgttgcacctgaagccaatttaaatgtaaagccatcagagagttttattttg
aaaacctacccagcctctttcacacaggaagagatggatgacaatttccaggcatttctt
aaggatgcatttgaagaaggatcgtttttggaacaatttcatagactgcaagaaaaagta
aaaagactctttgatgtaggtttcatatcctgtgcatggttactgaagaacaaagagctt
atcagatatcttgaggaaagtaactttgatgctctcttcactgaccctgtgtttccttgt
ggagcgatactggccgagcatctttccatcccttctgtgtatttcatgaggggaatgcca
tgtggattagactttgaggctactcaatgtcccaatcccccttcttatatccctagggca
tttacagaccataccgatcacatgaacttcctccagcgtgtgaagaatgtcatctttgat
acctcaaatctttttctctgtgactttatttttaaaccatatgaaaaactggcttctgag
ttccttcagcgagatgtgaccgtgatagatctcttacgtaaggcttccgtatggcttctg
aggtatgactttgtgttagattatccaaggccattgatgcccaacataattgtggttgga
ggaataaactgtgctcacaagcagctacctcaggaattcgaagccattgtaaatgcttcc
ggagaacacggtattgttgtcttctccctgggctccatggtctccgagatccccatgaag
aaagccatggaaattgcagatgctttgggatcagtccctcaaacggttttgtggcgatac
acaggagaggtgccccccaacctgccaaagaacgtgaagcttgtcaagtggctgccacag
aatgacctcctagctcatcctaagactcgtgcctttattacccatggaggctcacacggt
gtttacgagggcatatgcaatgcagtgccaatggtgctaatgcctttatttggagaccag
atggacaatgcgaaacgagtagagtcgcggggagcaggattgacactgaatatactagaa
atgacttcgaaagacatatccgatgccctgaaagcagttattaatgataaaaagtacaaa
gagaacatccagcgtctctcagacctccaccttgacaggcccatccaccctctggacctg
gctgtgcactgggtggagtttgtcatgagacacaaaggggccccacacctgcgccctgct
gcccatgacctgaactggattcagtatcactccctggacgtctttgccttcctcctggct
gtggtgctcctctccctcttcatttctgtgaagtgctgcatgttctgctgccgcaggtgc
tgctttaagaagggaagaaaaagcaagtcagggaaatcaaagacccactag

DBGET integrated database retrieval system