KEGG   Gallus gallus (chicken): 424029Help
Entry
424029            CDS       T01006                                 

Gene name
TRAF3IP1
Definition
NF receptor-associated factor 3 interacting protein 1
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
7
AA seq 665 aa AA seqDB search
MLPAGDGGGGAGAVPAVAMNEAVVRRTQECLGQVIRKPPLTDRLLSKPPFRYLHDVITEV
IRVTGFLKGLYTDFELKSDNVKDKDAKISFLQKAIDAVVMVTGEPLSVKPARVVAGHEPE
KTNEFLQAIGKCCLNKLSSDVAVKKILAGERADAKGKPPSSKPRDTESRESKTEDQKSRR
DKEGRGDTDIKDRSSSRDRKPKGDVKESEEREKESEKQKDNEDRHKDSERDNFKEGEKQE
RERNKSRTTKQGRETEKSKGKRDIEREDNIEWDKVQEREKKNEGGRETDRLKGRDKDKAR
EREREKDKEKGKDHERNRQRDRGKDGEHVQEHGKDKTEKKSESPAGISRQPSTKGSRQRA
KPRGEGTVEMKSVADGISEDNAAKLQEEAEPGLVVKQKEEEAENLDPEKPALSENGEVPN
HLPPQAIQRRIPRPGSARPAPPRVVKRQESTEALIPERNGSGKAISNVIVDQQASDDDDD
QFVVEAAMPVPEMPELEMEPEVDLVEDEKHGGLVKRILETKKDYEASQRSSKVTEKEKPF
VSEAARKKERDLVAKEVEKFRDSIQTLCRSAFTLGRIMDYVQEDMDAMKNELQMWRHENR
QHAEALQKEQSITDSAVEPLKAELAELDQLIEDQQDKIRAVKANILKNEDKIRRMVLSIN
LSSRR
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctcccagccggcgacggcggcggcggcgccggcgccgtccccgccgtcgctatgaac
gaggcggtggtacgacggactcaggagtgcttgggacaagtgatccgcaagccgcccttg
acggatcggctgctgagtaagccgcccttccgctacctgcacgacgtgatcaccgaggtg
attagagtgacaggcttcttgaaagggctttacacggattttgaattgaaatcagataac
gtcaaggataaagatgccaaaatcagcttccttcagaaggccattgatgctgttgtaatg
gtaacaggagagccactgtcagtaaaaccagcacgcgttgtggctggacacgaacctgag
aaaacaaatgagtttctgcaagccattgggaagtgttgcttaaataagctgtcaagtgat
gttgctgtaaaaaagattttagctggggaaagagctgatgctaaaggaaagcctccatcc
agtaaacctcgagatacagaaagcagggagtccaaaacagaagaccaaaaaagccgtagg
gacaaagagggaagaggagatactgacattaaagacagaagttcaagcagagacagaaaa
cccaaaggagatgtcaaagagagtgaagaaagagaaaaggaaagtgaaaaacagaaggat
aatgaagacaggcacaaagactctgaaagggacaactttaaggaaggagaaaaacaagaa
agggaaagaaacaaaagcagaacaaccaaacaaggaagagaaacagaaaaaagcaaggga
aaaagagacatagaacgagaagataatattgaatgggataaagtacaggaaagggagaaa
aaaaatgaaggaggaagagaaacagacagactgaaaggaagagacaaagataaggctagg
gagagagaacgagagaaagacaaagaaaagggaaaagaccatgaaaggaacagacagaga
gacagagggaaagatggggagcatgtacaagaacacggaaaggataaaacagagaaaaag
agtgaaagtcctgcaggaatatcaaggcagccttcaacaaaaggatcaaggcaacgcgcc
aaacccagaggagaaggaacagtagaaatgaagagtgtggcagatgggatttcagaggac
aatgctgctaaactgcaggaagaagctgaaccaggacttgtagtaaaacagaaagaagaa
gaagcagagaaccttgatcctgaaaagcctgcattatctgaaaatggcgaagtacccaat
catcttccacctcaggctatccaaagacgtattcctcgtcctggcagtgcaaggccagca
ccaccccgagtagtaaagcgtcaagagagcacggaggccttgattccagaaaggaacggt
agtggtaaagcaatctcaaatgtgatcgtagaccagcaggcttctgatgatgatgatgac
cagtttgtggtggaggcagccatgccagtgcctgaaatgccagagctggaaatggagcca
gaagtggatctggtggaggatgaaaagcatggtggacttgtaaaaagaatcctagaaaca
aaaaaggattatgaagcatcacagagatcatcaaaggtgacagagaaggagaagcctttt
gtatcagaagcagctaggaagaaagaaagagacttggtagccaaagaagtggagaagttt
cgggactctattcagactctgtgccgcagtgcctttacacttggcaggatcatggactac
gttcaagaagacatggatgccatgaagaacgagttgcagatgtggcggcatgagaacaga
cagcatgcagaagcactgcagaaagagcagagcatcacggacagtgctgtagaaccacta
aaagctgaactggctgagctggaccagctgattgaagaccagcaagacaagattcgtgct
gttaaagctaacattttaaagaatgaggacaaaatccggaggatggttcttagcataaac
ctgtcttcaagaaggtga

DBGET integrated database retrieval system