KEGG   Gallus gallus (chicken): 424071Help
Entry
424071            CDS       T01006                                 

Gene name
AOX1
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    424071 (AOX1)
   00350 Tyrosine metabolism
    424071 (AOX1)
   00380 Tryptophan metabolism
    424071 (AOX1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    424071 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    424071 (AOX1)
   00830 Retinol metabolism
    424071 (AOX1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    424071 (AOX1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     424071 (AOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 1328 aa AA seqDB search
MSLQGAVGAEELIFYVNGRKVVEKNADPEQMLLFYLRKRLRLTGTKYGCGGGGCGACTVM
ISTYEPASKKIRHYSANACLLPICCLYGMAVTTVEGVGSTRTRIHPVQERLAKCHGSQCG
FCTPGMVMSIYTLLRNHPEPTSEQMTAALAGNLCRCTGYRPILDACKTFCKDSVCCQSKA
NGRCCLDQEEDLFDREEKESVGLFSPDEFQPLDPTQEFIFPPELMRMAENQPKRALVFHG
ERIMWISPVSLDELQDLKAAHPEAPLVVGNTGVGPDMKFRGVFHPIVIAPARIPDLNVVE
RMSDGLTIGAACSLSLMKDVLRNAVSELPEEKTKIFCAVLQQLRTLGGEQIRNVASLGGN
SISRKSTSDMNPILAAGNCMLNLASQGGKRWIPLSDIFADGVGNNTIMPEEVLVSVRIPH
SRKGEYISAFRQAPRRENALPIISAGMRVLFEEGTDKIKDLSIFYGGAASTTICAKQTCQ
TLIGRYWNEQMLDEASRLILNEIVLPDSAWDGKAEYKKTLIVSLFYKFFLEVLQSLKTMD
PCHYPGIPMEYESILEDFQTKMPQSIQIYQNVELSQSPQDPVGRPIMHQSGIKHATGEAV
YIDDIPSVDGELFLAVVTSSRAHAKIVSVDTSEALKEPGVFDVITANDVPATNEFHYSDD
PEIIFARNKVICVGQIVCAVAADSYAHAKQAAAKVRIEYEALEPVILTIEDAIKHNSFFE
PKRKLEHGNVDKAFETVDHILEGEIHIGGQEHFYMETQSVLAIPKGEDKEMDVYVSTQHP
AFIQEMVAASLGVPANRIMCHVKRVGGAFGGKLLKAGLLASVASVAANKTNRAVRLILSR
GDDMLITGGRHPFIGKYKVGFMKDGRIRTVDAKYYINGGCTPDESVLVAEVCLLKMDNAY
KIPNLRCWAYACKTNLPSNTAFRGFGFPQSGLVTETWITEVAEKTGLSPEKVREINMYKE
DEQTHFKQKLDPQNLIRCWNECMEKSAYYSRKTAIEEFNKQNYWKKKGIAIVPMKFPFGL
GSRYLSQAAALVHIYTDGSVLLTHGGIELGQGIHTKMIQVASRELNIPMSYIHFCETSTT
TVPNACASVGSAGTDVNGMAVKDACQTLLKRLQPIINKNPKGNWKDWIKEAFEQSVSLSA
TGYFRGYDANMEWEKGEGQPFTYFLYGTAGTEVEINCLTGDHKNLRTDIVMDIGCSINPA
VDIGQIEGAFVQGIGLYTMEELKYSPEGVLCTRGPDHNKIPAVCDIPEQFNVSLLSSSQN
PYAIYSSKGLGGAGLFLGCSVFFALRDAITCVRNERGLKKTFALNSPLTAGQIRAACIDD
FTKMVIGR
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcaaggagcggtgggggctgaggagttgattttctacgtgaatgggagaaag
gtggtagagaaaaatgccgatcccgaacagatgctgctgttttatctgcgaaagagactc
cgtcttacaggaactaagtatggctgtggaggaggtggctgtggtgcctgcacggtgatg
atatcaacttatgagccagcttcaaagaagataagacactactcagcaaatgcgtgcttg
cttcccatttgctgcttgtatggtatggcagtcaccacagtggaaggtgttggaagtaca
agaaccagaattcatccagttcaggaaaggcttgccaaatgccatggctcccagtgtggt
ttctgtacccctggaatggtgatgtccatatacactttgttaagaaaccacccagaacca
acttcagagcagatgactgcagctctggctgggaacttgtgccgctgcactggatacagg
cccatcctagatgcctgtaaaaccttttgtaaggattctgtttgttgtcaaagtaaagca
aatggaaggtgttgcttggatcaagaagaggatttatttgacagagaagagaaggaatct
gttggactgttttcaccagatgaattccagcccttagatcccacccaagagtttatattt
ccgccagaactaatgagaatggctgaaaatcagccgaaaagggccctggtttttcatgga
gagcgaataatgtggatttctcctgtaagcttagatgaattacaggatctgaaggctgcc
caccctgaagcaccccttgttgttggaaatactggtgtgggacctgatatgaaatttaga
ggtgtgttccatccaattgtcattgctcctgccaggatcccagatctgaacgtggtggaa
cgcatgagtgatggattaactataggagctgcctgcagcctctctctaatgaaagacgtc
ttgagaaatgcagtttcggagttaccagaagaaaagacaaagattttctgtgctgtcttg
cagcagttaagaacactgggtggagaacagataagaaatgttgcttcattaggtggaaac
agtataagtcgaaaatcaacctcagacatgaatcctattctggctgctggcaattgtatg
cttaacctggcttcacaaggaggaaagagatggattcctttgagtgatatttttgcagat
ggagttggtaacaatactattatgccggaagaggtcttagtctctgtccgtattccccat
tctagaaagggagagtatatctctgcatttagacaagcaccaagaagagaaaatgctctc
ccaataattagtgctggaatgagagtcctttttgaagaaggtacagacaaaattaaagat
ttgagcattttctatggaggtgctgcctcgacaacgatctgtgcaaagcaaacctgtcag
acacttattggaaggtactggaatgagcagatgttggatgaagcttccaggctaatcctc
aatgaaatagttcttccagactcagcctgggatgggaaagcagaatataaaaaaactttg
atagttagtttattctacaaatttttcctggaagtattacagtcattgaagacaatggac
ccttgtcactatcctggcatacctatggaatatgagagcattctagaagacttccaaacc
aaaatgccccagagtatccaaatatatcagaatgtagagctgagtcagtctccccaggat
cctgtgggacggcctattatgcaccagtctggaattaagcatgccactggtgaagcagtt
tacattgatgatattccttctgtggatggggagctcttcctggctgttgtcactagttcc
agagctcatgctaagattgtctcagtagatacctcagaggctctgaaggaaccaggtgtg
tttgacgtcataacagctaatgatgtaccagctacaaatgagtttcactactctgatgat
ccagagattatatttgcaagaaacaaggtaatttgtgtgggtcagattgtatgcgctgta
gctgcagattcatatgctcatgccaaacaagctgctgcaaaagtgaggatagagtatgaa
gcactggaacctgtgatcttgacaattgaggatgctataaagcacaactcattctttgag
ccaaaaagaaaattagaacatggaaatgttgataaggcatttgaaactgttgatcatata
cttgaaggggagattcacattggggggcaggagcacttttatatggagactcagagtgtg
cttgctattccaaaaggagaggataaagaaatggatgtgtatgtttcaacacaacatcca
gcatttatccaggagatggtagctgcgagtctaggcgttccagcaaacaggatcatgtgc
cacgttaaacgagttggtggagcttttggtgggaaactcctgaaagctggtttactggca
tcagttgcttcagtggcagcaaacaaaaccaacagagcagtccgtcttattctgagccgg
ggagatgatatgttaatcactggtggccgacatccttttattggcaaatataaagttggc
ttcatgaaagatggtaggatcagaactgtggatgccaaatattacataaatggaggatgc
acccctgatgaatctgtcctggtagcagaagtatgcttactaaaaatggacaatgcgtat
aagattcccaacttgagatgctgggcttacgcttgtaaaacgaacttgccatcaaacaca
gcatttcgtggatttggttttcctcagtcaggactggtgacagaaacttggataacagaa
gttgcagagaaaacaggtttatcgccagaaaaggttagggaaataaatatgtataaggag
gatgagcaaacacacttcaaacaaaagcttgatccacaaaacttaatacgctgttggaat
gaatgtatggagaaatctgcatactacagtaggaaaacagctattgaggaattcaacaaa
caaaattactggaagaaaaaagggattgccattgttccaatgaagtttccatttggacta
ggctcacgttacctttctcaggctgctgctctggttcatatttatacagatgggtctgtg
cttttgacacatggtggaattgagctgggacagggcattcatacaaaaatgatccaggtt
gctagtcgggaattaaacatcccaatgtcatatattcacttctgtgaaacaagcacaaca
actgttcctaatgcgtgtgcttcagtaggatctgcagggacagatgtcaacggcatggct
gtgaaggatgcttgccaaactcttctgaaacgcctgcagcctatcattaacaagaaccca
aaaggcaactggaaagattggattaaagaagcctttgaacaaagtgtgagtctttcagct
actggctacttcagaggttacgatgcaaatatggaatgggagaaaggggaaggacagcct
ttcacatactttctttatggaactgctggtacagaggttgaaattaattgtttaacagga
gatcacaagaacctcagaacagacatagttatggacattggatgcagcataaatccagct
gtggatataggacagattgaaggcgcctttgttcaaggcattggactttacacaatggaa
gaattaaagtactctccagaaggagtcctatgtactcggggtccagatcacaataagatc
cctgctgtctgtgatattccagaacagtttaatgtttccctgctgtcatcttcccaaaat
ccatatgccatctattcatccaaggggttaggcggggcaggacttttcttgggatgctct
gtgttcttcgcgttgagggatgcaataacttgtgtgaggaatgaaagaggactaaaaaag
acctttgcactgaacagccctctgactgctggacaaatacgagcagcctgcatagatgac
ttcactaagatggtaataggaagatga

DBGET integrated database retrieval system