KEGG   Gallus gallus (chicken): 424072Help
Entry
424072            CDS       T01006                                 

Gene name
AOX2P, AOX2
Definition
aldehyde oxidase 2 pseudogene
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:gga00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gga00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:gga00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:gga00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gga00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:gga00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:gga00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 1337 aa AA seqDB search
MACLDKQSDDLVFFVNGKKVIERKADPEELLLYYLRKELRLSGTKYGCGVGGCGACTVML
STYDPVVKKIRHHPANSCLLPICSLHGAAVTTVEGVGSIKNRINPIQERLAKCHGSQCGF
CTPGMVMSIYALLRNHVKPSMEQIISALDGNLCRCTGYRPIIDSYASFAKEQTCCQLRGT
GQCCLDQEELGCSSSAGVRIRSGLCNPAEFLPVDPTQEFIFPPELMRMAQEQQGKTLIFC
SKRTTWISPSSLKELLELKAKYPKAPLVVGNTSLGLNKNDCDAYHPIVLHPLRIPEMQVV
SITDDGIVIGATCCLAQLRDILIETIPKLPEEKTKIYQALLQQLRTLAGEQIRSMASLGG
HVVSRGSAWDLNPILCAGKSVLNLASDGGKRQIFLDDQFLAGHKHADIEPKEVIVSVLIP
YSTKDEFISAFKQAERQKNAFSIVNSGLRVLFSPGTDTIVDLSILYGGIGSTTLSARKSC
EKLIGRQWNDQMLSEACKLVLEEISLPPSASGGKVEYRRTLLVSFLFRFYLEVLHGLHQM
YPFRYSELSQDKMSALGVLQSGVPQGVQLYQDVDPGQSPQDPVGRPIMHQSGIKHATGEA
VFIDDIRPVDRELSLAVVTSIKAHAKIKSIDISEALQVPGVINVVTAKDVPGKNGNDEEE
AFAKDKVICVGQIICAVVAETLTQAKHGAKKVKIVYEDLQPVLTIKDAIEHNSYITEERK
LEKGDIEKGFKSADKIIEGELHMGGQEHFYLETNSVLVIPRMEDKEMDVYVSTQHATDVQ
KLVASALNLQSNKIMCHTKRVGGAFGGKITKPSFFAVIAAVAANKTGRPVRFALERNMDM
LITGGRHPFFGKYKVGFMKDGRIIAADFQCYINGGCTKDESELVIEYIVLKVDNAYNIPN
LRVRGHACKTNLPSNTAFRGFGFPQAGLFVETCIVAVATKTGLPHEKVREKNMYRGVNRT
AFKEEFDAENLWKCWKECLDKSDYHSRNAKVEEFNRKNYWKKKGIAIIPMKFSVGFNATY
FHQAGALVHIYLDGSVLVTHGGIELGQGIHTKMLQIASRELKIPLSYIHFCETSSTTVPN
GKYTAGSVGTEINARAVQDACQILWKRLDPIRRKNPKGKWEDWISEAHKKSISLSATGYF
KGYVTNMDWETKKGHAFPYFLYGAACSEVEIDCLTGAHKNIRTDIVMDASFSINPAIDIG
QIEGAFIQGVGLYTLEEIYFSPEGEQLTLGPDTYKIPAVCDIPEQFHVYLVPNSCNSIAI
YSSKGMGEAGFFLGSSVFFAIRDAVAAARKERGLPLDFTLISPLTAERIRMACDDIFTKM
IPKDKPGTYKPWAIDIS
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttgacaaacaatcagatgaccttgtcttttttgtgaatggcaagaaggta
attgagaggaaggcagatcctgaagaattactcctgtattatctaagaaaggaactccgt
ctctcaggaacaaaatatggctgtggagtcggaggctgtggtgcatgcactgtgatgttg
tctacgtatgacccagttgtcaagaagatacgacaccatcctgccaactcctgcctgctc
cccatatgctcactgcatggtgctgctgttactactgtggaaggggttggaagcataaaa
aacaggattaatccaattcaggaaagacttgccaaatgccatggctcccagtgtggcttc
tgcacccctggaatggtgatgtccatatatgctttactaagaaaccatgtgaaaccttcc
atggaacagataatttctgctctggatggtaatttatgccgctgcacaggatacaggcca
attatagacagctatgcatcttttgctaaggagcaaacatgttgccagctgagaggaact
gggcaatgttgcttggatcaggaagaacttgggtgctcatcttctgcaggagttcggatt
cgttcaggtctttgtaatccagcagaattcctacccgtggatccaacacaagaatttata
tttcctcctgaactaatgagaatggctcaagaacagcaaggaaaaactcttattttctgc
agtaagagaacaacatggatttctccctctagcctgaaggagcttctggagctgaaagcc
aagtatccaaaggcacctctggttgtggggaacaccagtttaggactcaacaaaaatgac
tgtgatgcctatcatccaatcgttctccatcctttgaggattccagaaatgcaagttgtg
agtatcacagatgatgggatagtaataggagctacctgttgcctcgcccagctcagagat
attctcattgagactatcccaaaactcccagaggagaaaacaaaaatctaccaagctctc
ttgcagcagctgagaactctggctggagaacagatcaggagcatggcgtctttaggagga
catgttgtcagcaggggatcagcctgggacttgaacccaatcttatgtgctggcaaatct
gttctcaacttggcatcagatggtggcaagcgacagatttttttagatgaccagtttctt
gctggccataaacatgcagacatagagcccaaggaggtcattgtttctgttcttatccca
tattctacaaaggatgagtttatttcagccttcaaacaagctgaacgtcaaaaaaatgct
ttttccatagtgaattctggattgcgagtcctcttcagtccaggcacagacacaattgta
gatctgagtattttatatggaggcattggctcaaccacactcagtgcaagaaagtcttgt
gagaagctcattggaagacagtggaatgatcagatgctgagtgaagcttgcaaactggtg
ctggaggaaatttctcttcctccatcagcttcaggtggaaaagtagagtatagaagaact
ctgcttgtcagcttcttattcagattttacctggaagtgttacatggcttacatcagatg
taccccttcaggtattctgaactctcacaggataagatgagtgctttgggagtgctacaa
agtggtgttccccagggtgtccagctctatcaggatgttgacccagggcagtctccacaa
gaccctgtgggtcgtcccatcatgcaccagtctggtattaagcacgccactggtgaagcg
gttttcattgacgacattcgtccagtggatagagaactttcattggctgtggtcactagc
attaaagcccatgcaaagattaaatcaattgacatttcagaagcccttcaggtgccagga
gtgattaatgtggtaacagcaaaagatgttccagggaaaaatggcaatgatgaagaggaa
gcatttgcaaaagacaaggtcatttgtgttggacagataatctgtgccgtggttgcagag
acactgacacaggccaagcatggagctaaaaaggtgaagatagtgtatgaagatctgcag
ccagtcctcaccattaaggatgcaatagaacataattcatacattactgaagaaaggaaa
ctagaaaaaggagatattgagaaaggatttaagtctgctgataagatcatagaaggtgaa
ttgcacatgggaggacaggaacatttctacctggagacaaatagtgtgcttgttattcca
agaatggaagataaagaaatggatgtgtatgtatcaactcagcatgcaacagatgtacag
aaattagtggcttcagctttaaacctccagtccaacaaaattatgtgtcacacgaaacgt
gttggtggagcatttggtgggaagataactaagccttcattctttgctgtaattgcagca
gtggcagccaacaagaccgggcgcccagttcgttttgcccttgaaagaaacatggacatg
ttaatcactggtggacgtcaccctttctttggaaaatataaagtcggattcatgaaggat
ggtagaataatagccgcagattttcaatgctatataaatggtggctgtacaaaagatgaa
tctgagttggtgattgagtatatcgtgctgaaagtggacaatgcatataatatccctaat
ctccgagtcaggggccatgcctgcaagactaatttgccttctaatactgcctttcgagga
tttgggtttcctcaggcaggtctgtttgtggagacctgtattgtggctgtggcaaccaag
actggactaccacatgagaaggttagggaaaaaaacatgtacagaggagttaaccggaca
gccttcaaagaagaatttgatgcagagaatctgtggaaatgttggaaggaatgtttggat
aagtctgactaccacagccggaacgcaaaggtggaagagtttaacaggaagaattactgg
aaaaagaaagggattgccatcattcccatgaaattttctgttggatttaatgcaacctat
tttcatcaggctggtgctcttgtccatatctacttagatgggtctgtactagtcactcat
ggtggcattgaacttggacaaggaattcacactaagatgttacagattgccagtcgtgaa
ctgaagataccactgtcatatatacacttctgtgaaacaagctcaacaaccgtacctaat
ggcaaatacacagcaggatcagttgggacagaaatcaatgcaagagcagtacaggatgct
tgtcaaatcctttggaagcgtctggaccctatccgaagaaagaatcctaaaggcaaatgg
gaagactggatcagtgaagctcacaagaagagcatcagcctttcagctactggttatttc
aaaggttatgtgacaaacatggactgggaaacaaagaaaggccatgcattcccatatttt
ctctatggagctgcctgttctgaagtagaaattgactgccttacaggagcacacaagaac
attaggacagacattgtgatggatgcctcttttagcataaatccagctatagatatagga
cagattgaaggggccttcattcagggggttggtctttacacattagaagaaatctacttt
tccccagaaggagagcagctcactcttggcccagatacatacaagatccctgctgtttgt
gacattcctgagcaattccatgtctacttagtaccaaattcatgcaactcaattgctatc
tattcttccaagggcatgggcgaggctggattcttcctgggcagttcagtgttttttgca
atacgtgatgcagtggctgctgcacggaaagaaagaggactacccctggacttcacgctg
atcagccccttgaccgctgagcggattcgtatggcctgtgatgatatctttactaagatg
attccaaaagataaacctggaacctataagccgtgggccattgatatatcctaa

DBGET integrated database retrieval system