KEGG   Gallus gallus (chicken): 424072Help
Entry
424072            CDS       T01006                                 

Gene name
AOX2P, AOX2
Definition
aldehyde oxidase 2 pseudogene
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    424072 (AOX2P)
   00350 Tyrosine metabolism
    424072 (AOX2P)
   00380 Tryptophan metabolism
    424072 (AOX2P)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    424072 (AOX2P)
   00760 Nicotinate and nicotinamide metabolism
    424072 (AOX2P)
   00830 Retinol metabolism
    424072 (AOX2P)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    424072 (AOX2P)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     424072 (AOX2P)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 1337 aa AA seqDB search
MACLDKQSDDLVFFVNGKKVIERKADPEELLLYYLRKELRLSGTKYGCGVGGCGACTVML
STYDPVVKKIRHHPANSCLLPICSLHGAAVTTVEGVGSIKNRINPIQERLAKCHGSQCGF
CTPGMVMSIYALLRNHVKPSMEQIISALDGNLCRCTGYRPIIDSYASFAKEQTCCQLRGT
GQCCLDQEELGCSSSAGVRIRSGLCNPAEFLPVDPTQEFIFPPELMRMAQEQQGKTLIFC
SKRTTWISPSSLKELLELKAKYPKAPLVVGNTSLGLNKNDCDAYHPIVLHPLRIPEMQVV
SITDDGIVIGATCCLAQLRDILIETIPKLPEEKTKIYQALLQQLRTLAGEQIRSMASLGG
HVVSRGSAWDLNPILCAGKSVLNLASDGGKRQIFLDDQFLAGHKHADIEPKEVIVSVLIP
YSTKDEFISAFKQAERQKNAFSIVNSGLRVLFSPGTDTIVDLSILYGGIGSTTLSARKSC
EKLIGRQWNDQMLSEACKLVLEEISLPPSASGGKVEYRRTLLVSFLFRFYLEVLHGLHQM
YPFRYSELSQDKMSALGVLQSGVPQGVQLYQDVDPGQSPQDPVGRPIMHQSGIKHATGEA
VFIDDIRPVDRELSLAVVTSIKAHAKIKSIDISEALQVPGVINVVTAKDVPGKNGNDEEE
AFAKDKVICVGQIICAVVAETLTQAKHGAKKVKIVYEDLQPVLTIKDAIEHNSYITEERK
LEKGDIEKGFKSADKIIEGELHMGGQEHFYLETNSVLVIPRMEDKEMDVYVSTQHATDVQ
KLVASALNLQSNKIMCHTKRVGGAFGGKITKPSFFAVIAAVAANKTGRPVRFALERNMDM
LITGGRHPFFGKYKVGFMKDGRIIAADFQCYINGGCTKDESELVIEYIVLKVDNAYNIPN
LRVRGHACKTNLPSNTAFRGFGFPQAGLFVETCIVAVATKTGLPHEKVREKNMYRGVNRT
AFKEEFDAENLWKCWKECLDKSDYHSRNAKVEEFNRKNYWKKKGIAIIPMKFSVGFNATY
FHQAGALVHIYLDGSVLVTHGGIELGQGIHTKMLQIASRELKIPLSYIHFCETSSTTVPN
GKYTAGSVGTEINARAVQDACQILWKRLDPIRRKNPKGKWEDWISEAHKKSISLSATGYF
KGYVTNMDWETKKGHAFPYFLYGAACSEVEIDCLTGAHKNIRTDIVMDASFSINPAIDIG
QIEGAFIQGVGLYTLEEIYFSPEGEQLTLGPDTYKIPAVCDIPEQFHVYLVPNSCNSIAI
YSSKGMGEAGFFLGSSVFFAIRDAVAAARKERGLPLDFTLISPLTAERIRMACDDIFTKM
IPKDKPGTYKPWAIDIS
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atggcttgccttgacaaacaatcagatgaccttgtcttttttgtgaatggcaagaaggta
attgagaggaaggcagatcctgaagaattactcctgtattatctaagaaaggaactccgt
ctctcaggaacaaaatatggctgtggagtcggaggctgtggtgcatgcactgtgatgttg
tctacgtatgacccagttgtcaagaagatacgacaccatcctgccaactcctgcctgctc
cccatatgctcactgcatggtgctgctgttactactgtggaaggggttggaagcataaaa
aacaggattaatccaattcaggaaagacttgccaaatgccatggctcccagtgtggcttc
tgcacccctggaatggtgatgtccatatatgctttactaagaaaccatgtgaaaccttcc
atggaacagataatttctgctctggatggtaatttatgccgctgcacaggatacaggcca
attatagacagctatgcatcttttgctaaggagcaaacatgttgccagctgagaggaact
gggcaatgttgcttggatcaggaagaacttgggtgctcatcttctgcaggagttcggatt
cgttcaggtctttgtaatccagcagaattcctacccgtggatccaacacaagaatttata
tttcctcctgaactaatgagaatggctcaagaacagcaaggaaaaactcttattttctgc
agtaagagaacaacatggatttctccctctagcctgaaggagcttctggagctgaaagcc
aagtatccaaaggcacctctggttgtggggaacaccagtttaggactcaacaaaaatgac
tgtgatgcctatcatccaatcgttctccatcctttgaggattccagaaatgcaagttgtg
agtatcacagatgatgggatagtaataggagctacctgttgcctcgcccagctcagagat
attctcattgagactatcccaaaactcccagaggagaaaacaaaaatctaccaagctctc
ttgcagcagctgagaactctggctggagaacagatcaggagcatggcgtctttaggagga
catgttgtcagcaggggatcagcctgggacttgaacccaatcttatgtgctggcaaatct
gttctcaacttggcatcagatggtggcaagcgacagatttttttagatgaccagtttctt
gctggccataaacatgcagacatagagcccaaggaggtcattgtttctgttcttatccca
tattctacaaaggatgagtttatttcagccttcaaacaagctgaacgtcaaaaaaatgct
ttttccatagtgaattctggattgcgagtcctcttcagtccaggcacagacacaattgta
gatctgagtattttatatggaggcattggctcaaccacactcagtgcaagaaagtcttgt
gagaagctcattggaagacagtggaatgatcagatgctgagtgaagcttgcaaactggtg
ctggaggaaatttctcttcctccatcagcttcaggtggaaaagtagagtatagaagaact
ctgcttgtcagcttcttattcagattttacctggaagtgttacatggcttacatcagatg
taccccttcaggtattctgaactctcacaggataagatgagtgctttgggagtgctacaa
agtggtgttccccagggtgtccagctctatcaggatgttgacccagggcagtctccacaa
gaccctgtgggtcgtcccatcatgcaccagtctggtattaagcacgccactggtgaagcg
gttttcattgacgacattcgtccagtggatagagaactttcattggctgtggtcactagc
attaaagcccatgcaaagattaaatcaattgacatttcagaagcccttcaggtgccagga
gtgattaatgtggtaacagcaaaagatgttccagggaaaaatggcaatgatgaagaggaa
gcatttgcaaaagacaaggtcatttgtgttggacagataatctgtgccgtggttgcagag
acactgacacaggccaagcatggagctaaaaaggtgaagatagtgtatgaagatctgcag
ccagtcctcaccattaaggatgcaatagaacataattcatacattactgaagaaaggaaa
ctagaaaaaggagatattgagaaaggatttaagtctgctgataagatcatagaaggtgaa
ttgcacatgggaggacaggaacatttctacctggagacaaatagtgtgcttgttattcca
agaatggaagataaagaaatggatgtgtatgtatcaactcagcatgcaacagatgtacag
aaattagtggcttcagctttaaacctccagtccaacaaaattatgtgtcacacgaaacgt
gttggtggagcatttggtgggaagataactaagccttcattctttgctgtaattgcagca
gtggcagccaacaagaccgggcgcccagttcgttttgcccttgaaagaaacatggacatg
ttaatcactggtggacgtcaccctttctttggaaaatataaagtcggattcatgaaggat
ggtagaataatagccgcagattttcaatgctatataaatggtggctgtacaaaagatgaa
tctgagttggtgattgagtatatcgtgctgaaagtggacaatgcatataatatccctaat
ctccgagtcaggggccatgcctgcaagactaatttgccttctaatactgcctttcgagga
tttgggtttcctcaggcaggtctgtttgtggagacctgtattgtggctgtggcaaccaag
actggactaccacatgagaaggttagggaaaaaaacatgtacagaggagttaaccggaca
gccttcaaagaagaatttgatgcagagaatctgtggaaatgttggaaggaatgtttggat
aagtctgactaccacagccggaacgcaaaggtggaagagtttaacaggaagaattactgg
aaaaagaaagggattgccatcattcccatgaaattttctgttggatttaatgcaacctat
tttcatcaggctggtgctcttgtccatatctacttagatgggtctgtactagtcactcat
ggtggcattgaacttggacaaggaattcacactaagatgttacagattgccagtcgtgaa
ctgaagataccactgtcatatatacacttctgtgaaacaagctcaacaaccgtacctaat
ggcaaatacacagcaggatcagttgggacagaaatcaatgcaagagcagtacaggatgct
tgtcaaatcctttggaagcgtctggaccctatccgaagaaagaatcctaaaggcaaatgg
gaagactggatcagtgaagctcacaagaagagcatcagcctttcagctactggttatttc
aaaggttatgtgacaaacatggactgggaaacaaagaaaggccatgcattcccatatttt
ctctatggagctgcctgttctgaagtagaaattgactgccttacaggagcacacaagaac
attaggacagacattgtgatggatgcctcttttagcataaatccagctatagatatagga
cagattgaaggggccttcattcagggggttggtctttacacattagaagaaatctacttt
tccccagaaggagagcagctcactcttggcccagatacatacaagatccctgctgtttgt
gacattcctgagcaattccatgtctacttagtaccaaattcatgcaactcaattgctatc
tattcttccaagggcatgggcgaggctggattcttcctgggcagttcagtgttttttgca
atacgtgatgcagtggctgctgcacggaaagaaagaggactacccctggacttcacgctg
atcagccccttgaccgctgagcggattcgtatggcctgtgatgatatctttactaagatg
attccaaaagataaacctggaacctataagccgtgggccattgatatatcctaa

DBGET integrated database retrieval system