KEGG   Gallus gallus (chicken): 424171Help
Entry
424171            CDS       T01006                                 

Gene name
G6PC2
Definition
glucose-6-phosphatase, catalytic, 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    424171 (G6PC2)
   00052 Galactose metabolism
    424171 (G6PC2)
   00500 Starch and sucrose metabolism
    424171 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    424171 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    424171 (G6PC2)
   04920 Adipocytokine signaling pathway
    424171 (G6PC2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     424171 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
7
AA seq 355 aa AA seqDB search
MDLLHSNGVLIIQHLQRDYRAYQDFLNFMSHVGDPRNIFSFYFPLWFQLNQVVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWVHETMIYPNQSSPCLEQFPITCETGPGSPSGHAMGSS
CVWYVMVTAALSYTVRWKEKSAVTLHRLTWSLLWTIFWIIQISVCISRVFIATHFPHQVI
LGVFAGIVVAEAFEHTPAIQTASLRMYIKTNLFLFIFALGFYLVLKLLDIDLLWSVPKAK
KWCANPDWINIDTTPFAGLVRNLGAFFGLGIGINSEMFITSCKGKNSCKLSFRVLCIAAS
LATLQLYNFVKIPTHTEYLFYILSFCKSAAMPLTVVALVPYCVHTLMRTTDKKCN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatctccttcatagcaatggagtgcttatcattcagcatttacagagagactacagg
gcttaccaggatttccttaattttatgtcacatgttggagatcctcggaatatattctca
ttttattttcctctttggtttcagctcaaccaagtggttggtactaaaatgatatgggtg
gcagtcattggtgattggttcaacctcatatttaaatggattttatttggccatcgtccc
tactggtgggtgcatgaaacaatgatttatcccaatcagtcaagcccatgcctcgaacag
tttcccataacatgtgaaactggaccagggagtccatctggacatgccatgggatcttcc
tgcgtctggtatgtaatggtaacagcagcacttagctacactgtgaggtggaaagagaaa
tcagcagttacccttcacagactgacatggtcattactctggactattttttggattatc
cagatcagtgtgtgcatctcaagagtattcatagcaacacatttccctcatcaagttatt
cttggagtatttgctggaattgttgtggcagaagcatttgagcatacccctgctattcag
acagcaagcttgagaatgtacatcaagacaaacttgtttcttttcatctttgcccttggt
ttttacctagtcctgaagcttcttgatattgacttgctgtggtctgttccaaaggccaag
aagtggtgtgcgaatccagactggataaacattgacacaactccatttgctggactggtg
agaaatttaggtgcattctttggcttaggtattggtattaattctgaaatgttcatcacc
agctgcaaaggtaaaaacagctgtaagctaagtttccgcgtactgtgtatagctgcttcg
ttagctacactacagctgtataattttgttaagatacctactcatactgagtatttgttc
tacattctctctttttgtaagagtgcagctatgcctctgactgtagtcgccttggttcca
tactgtgtccacacgttaatgaggacaactgataagaaatgtaattag

DBGET integrated database retrieval system