KEGG   Gallus gallus (chicken): 424197Help
Entry
424197            CDS       T01006                                 

Gene name
INHA
Definition
(RefSeq) inhibin alpha subunit
  KO
K05500  
inhibin, alpha
Organism
gga  Gallus gallus (chicken)
Brite
Cytokines [BR:gga04052]
 TGF-beta family
  Distant members
   424197 (INHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 329 aa AA seqDB search
MLLLLHLLPAVLPASALGSCTGAGADRQLVLAKVRARVLEHLSPPAMQEPQKDVRRVHRR
DVLEEVEVPPEEQEDTSQVILFPSTDVPCEPTQPDKLLEEEGIFTYLFQPSAHALSRTLT
SAQLWFYSGPSAAPNHSAPAVLTLSPQGRVPVVATASRTPEHWTVFDFGPDALPQLAQPL
FVLLVRCPGCPCLADGDKMPFLVATTRAKAAGRARRSAVPWSPAALSLLQRPSEDVAAHT
NCRRASLNISFEELGWDNWIVHPSSFVFHYCHGNCAEGHGLSHRLGVQLCCAALPGTMRS
LRVRTTSDGGYSFKYETVPNILAQDCTCV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctcctgcacctgctgcctgccgtgctgcctgccagtgccctgggcagctgt
actggggccggcgccgaccgacagctcgtcctggccaaggtgcgggcacgggtgctggag
catttgagccccccggccatgcaggagccccaaaaggatgtgaggagggtgcaccgcaga
gatgtcctcgaagaggtggaggtgccacctgaggagcaggaggacacatcccaggtgatt
ctcttcccttccacagacgtgccgtgcgagcccacgcagccagacaagctgctggaggaa
gaaggcatcttcacttacctcttccagccctcggcgcacgccctgagccgcacgctgaca
tccgcccagctctggttctacagcggcccctcggctgctcccaaccactcggcccccgct
gtgctgaccctctcaccgcagggcagggtgccggtggtggccacagcgtcgcggacgccg
gagcactggaccgtgtttgacttcggccccgatgcgctgccccagctggcacagccgctc
ttcgtgctcctggtgcgctgccccggctgcccctgcctggccgatggggacaagatgccc
ttcctggtggccactacccgtgccaaggcagccgggagggctcgccgctccgccgtgccc
tggtcgccggctgcgctcagcctgctgcagcgcccatcggaggacgtggccgcccacacc
aactgccgccgggcgtccctcaacatctctttcgaggagctgggctgggacaattggatc
gtgcaccccagcagcttcgttttccactactgccacgggaactgtgccgaaggccacggg
ctgagccaccggctgggggtgcagctgtgctgcgccgcgctgcccggcaccatgcgctca
ctgcgtgtccgcaccacctctgatggtggctactccttcaagtacgagacggtgcccaac
atcctggcgcaggactgcacctgtgtctag

DBGET integrated database retrieval system