KEGG   Gallus gallus (chicken): 424214Help
Entry
424214            CDS       T01006                                 

Definition
(RefSeq) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4-like
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04933  AGE-RAGE signaling pathway in diabetic complications
Module
gga_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    424214
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    424214
   04070 Phosphatidylinositol signaling system
    424214
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    424214
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     424214
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    424214
 Endocytosis
  Macropinocytosis
   Phospholipase C
    424214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 PH_12 DUF4028 Mcp5_PH
Motif
Other DBs
NCBI-GeneID: 424214
NCBI-ProteinID: XP_004942927
CGNC: 52153
Ensembl: ENSGALG00000026687
Position
7
AA seq 838 aa AA seqDB search
MGHRRGRGVGVGERKEGHASSSLPFSGCSWPLLGGSWLSQSCWKSPYLFKKQCQHRGGRV
MASLLCNARIQLTETLEKMQQGTLMRKVKSKSWKKQRYFKLQDDCMTIWYQSKRTGKTES
AFSISDVETVREGHQSEVLQSLAEEFPPERCFTIVFYGRRGNLDLIAGTEEEAQCWVQGL
RQLIEVATSMDQRERIDQWIRDWFQKADKNKDGRMNFKEVQRLLKMMNVDMNEDHALRLF
QAADKSESGTLEGEEFVLFYKALTEREEVQSLFREFSEDGKKLTLLELVDFLRQEQLEEE
GTEELAMELIDKYEPSETARARHALSADGFLMYLCSPEGSIFNPQHRALWQDMTQPLCHY
FISSSHNTYLIEDQIRGQSSIEGYIRALKRGCRCLEVDCWDGPNGEPIVYHGHTFTSKIP
FREVVSTLGKYAFQASDFPVILSLENHCSMEQQEVLAQQLKDILGEQLLTATTDGRVPTQ
LPSPEELKHKILLKGKKIGRLEDTLDGPGDEAPDVSDDDNGAEAEEERRRMKKDRESLAQ
ALSDCVVYCKNVSFRGFQEARNHSRPSEISSLSEAKARKLIRDAGNEFVRHNTWQLTRIY
PSGMRTDSSNYSPQEMWNAGCQIVALNFQTAGMEMDLCDGLFSQNGHCGYVLKPAFMRDE
GTLFNPSDPSTWQGPGPVTLTIQVISGQQLPKVANSKDGAIIDPLVRVEIHGVPADQAHQ
ETKYIENNGEPVVRGPAVPVPALSPTSACSPLPGFNPHWDETLQFQLHVPQLALVRFVVE
DYDKTSRNDFVGQFTLAFANIKPGYRHIHLLSKDGTGIPPSSLFVHIRITEPPGPEQD
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggggcacaggagggggaggggggttggtgtgggtgagagaaaggagggccatgccagc
tcctcattgcccttctctgggtgctcgtggcctttgctgggaggcagctggctgtcacag
agctgctggaagtctccctatctcttcaagaagcagtgccaacacagaggaggcagagtc
atggcatcgctgctgtgcaacgcccgcatccagctcacggaaacgctggagaagatgcag
caagggacgctgatgaggaaagtcaaatccaagagctggaagaagcagaggtacttcaag
ctgcaggatgactgcatgaccatctggtaccaatccaagaggacgggcaaaactgagtct
gccttctccatcagtgatgtggagacagtgcgggaagggcaccagtcagaggtgttgcag
agcctggccgaggagttcccccccgagcgctgcttcaccatcgttttctacgggcgtcgg
ggcaacctggacctcatcgctggcacagaggaggaggcgcagtgctgggtccagggcctg
cgccagctcatcgaagtggccaccagcatggaccagagggagaggatagaccagtggatt
cgtgactggttccagaaagctgacaagaataaggacgggcgcatgaacttcaaggaggtg
cagcgtctcctcaagatgatgaacgtggacatgaatgaggaccatgccctgcgactcttc
caggctgccgacaagtcggagtcagggacgctggaaggggaagagtttgtgctcttctat
aaagccctcacggagcgcgaggaggtgcagagcctcttccgggagttctctgaggacggg
aagaagctgacgctgctggagctggtggatttcctgcggcaggagcagctggaggaggag
ggcacggaggagctcgctatggagctcattgacaagtacgagccctcggagacagccaga
gctcgccacgcgctgagtgctgacgggttcctcatgtacctctgctccccggagggctcc
atcttcaatcctcagcaccgggctctgtggcaggacatgacccagcctctctgccactac
ttcatctcctcctctcacaacacctacctgatagaggaccagatccggggtcagagcagc
atcgaaggctacatcagggctctgaaacggggctgccgctgcctggaggtggattgctgg
gacgggccgaacggggagcccatagtgtaccacggccacaccttcacctccaagatcccc
ttcagggaggtggtgagcaccctggggaagtacgccttccaggcttccgacttcccggtg
attctgtccctggagaatcactgcagcatggagcagcaggaggtgctcgcccagcagctg
aaggacatcctgggggagcagctcctcaccgccaccaccgacgggcgcgtccccacccag
ctcccatccccggaggagctgaagcacaagatcctgctgaaggggaagaagatcgggcgg
ctggaggacacgctggatgggccaggggatgaggcacccgatgtgtctgatgatgacaat
ggggcagaggcagaggaggagaggcggaggatgaagaaggacagggagagcctggcgcag
gcgttgtctgactgcgttgtctactgcaagaatgtgtccttccggggtttccaggaggcc
cgcaaccactcccggccctctgaaatctcctccctctccgaggcgaaggccaggaagctc
atccgggatgcagggaatgagtttgtccggcacaacacctggcagctgacacgcatctac
cccagcgggatgcggacagactcctccaattacagcccccaggagatgtggaacgcaggg
tgtcagatcgtggccctgaacttccagacagctggcatggagatggacctgtgtgatggg
ctgttcagccagaatggtcactgtggctacgtgcttaaaccagccttcatgagggatgaa
gggactctcttcaaccccagtgaccccagcacctggcagggccccggccccgtcaccttg
acaatccaggtgatcagcgggcagcagctgcccaaagtggccaacagcaaggatggagcc
atcatcgaccccctggtgcgcgtggagatccacggggtgccggcagaccaggcacaccag
gagaccaagtacatcgagaacaacggtgagcctgtggtacggggacccgctgtgcctgtc
cctgccctgtcacccaccagtgcctgctctcctttaccagggtttaacccccactgggac
gagacccttcagttccagctccacgtgccccagctggcccttgtccgctttgtggtggag
gattatgacaagacctccaggaacgatttcgtgggacagttcaccctggcctttgccaac
atcaaacctggctaccgccacatccatctcctctccaaggatggcaccggcatcccgccc
tcttcgctctttgtccacatccgcatcaccgagccgcctggccccgagcaagactga

DBGET integrated database retrieval system