KEGG   Gallus gallus (chicken): 424214Help
Entry
424214            CDS       T01006                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    424214
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    424214
   04070 Phosphatidylinositol signaling system
    424214
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     424214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
7
AA seq 879 aa AA seqDB search
MGHRRGRGVGVGERKEGHASSSLPFSGCSWPLLGGSWLSQSCWKSPYLFKKQCQHRGGRV
MASLLCNARECPGRGVRAGRWVESIHPPSWVPEAGGREVPSAMQPALPPGIQLTETLEKM
QQGTLMRKVKSKSWKKQRYFKLQDDCMTIWYQSKRTGKTESAFSISDVETVREGHQSEVL
QSLAEEFPPERCFTIVFYGRRGNLDLIAGTEEEAQCWVQGLRQLIEVATSMDQRERIDQW
IRDWFQKADKNKDGRMNFKEVQRLLKMMNVDMNEDHALRLFQAADKSESGTLEGEEFVLF
YKALTEREEVQSLFREFSEDGKKLTLLELVDFLRQEQLEEEGTEELAMELIDKYEPSETA
RARHALSADGFLMYLCSPEGSIFNPQHRALWQDMTQPLCHYFISSSHNTYLIEDQIRGQS
SIEGYIRALKRGCRCLEVDCWDGPNGEPIVYHGHTFTSKIPFREVVSTLGKYAFQASDFP
VILSLENHCSMEQQEVLAQQLKDILGEQLLTATTDGRVPTQLPSPEELKHKILLKGKKIG
RLEDTLDGPGDEAPDVSDDDNGAEAEEERRRMKKDRESLAQALSDCVVYCKNVSFRGFQE
ARNHSRPSEISSLSEAKARKLIRDAGNEFVRHNTWQLTRIYPSGMRTDSSNYSPQEMWNA
GCQIVALNFQTAGMEMDLCDGLFSQNGHCGYVLKPAFMRDEGTLFNPSDPSTWQGPGPVT
LTIQVISGQQLPKVANSKDGAIIDPLVRVEIHGVPADQAHQETKYIENNGEPVVRGPAVP
VPALSPTSACSPLPGFNPHWDETLQFQLHVPQLALVRFVVEDYDKTSRNDFVGQFTLAFA
NIKPGYRHIHLLSKDGTGIPPSSLFVHIRITEPPGPEQD
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggggcacaggagggggaggggggttggtgtgggtgagagaaaggagggccatgccagc
tcctcattgcccttctctgggtgctcgtggcctttgctgggaggcagctggctgtcacag
agctgctggaagtctccctatctcttcaagaagcagtgccaacacagaggaggcagagtc
atggcatcgctgctgtgcaacgcccgtgagtgtcccggcagaggggtgcgtgcagggcgc
tgggtggagtccattcatcctccatcctgggtcccagaggctggagggagggaggtcccc
tcggcgatgcagcctgctctgcccccaggcatccagctcacggaaacgctggagaagatg
cagcaagggacgctgatgaggaaagtcaaatccaagagctggaagaagcagaggtacttc
aagctgcaggatgactgcatgaccatctggtaccaatccaagaggacgggcaaaactgag
tctgccttctccatcagtgatgtggagacagtgcgggaagggcaccagtcagaggtgttg
cagagcctggccgaggagttcccccccgagcgctgcttcaccatcgttttctacgggcgt
cggggcaacctggacctcatcgctggcacagaggaggaggcgcagtgctgggtccagggc
ctgcgccagctcatcgaagtggccaccagcatggaccagagggagaggatagaccagtgg
attcgtgactggttccagaaagctgacaagaataaggacgggcgcatgaacttcaaggag
gtgcagcgtctcctcaagatgatgaacgtggacatgaatgaggaccatgccctgcgactc
ttccaggctgccgacaagtcggagtcagggacgctggaaggggaagagtttgtgctcttc
tataaagccctcacggagcgcgaggaggtgcagagcctcttccgggagttctctgaggac
gggaagaagctgacgctgctggagctggtggatttcctgcggcaggagcagctggaggag
gagggcacggaggagctcgctatggagctcattgacaagtacgagccctcggagacagcc
agagctcgccacgcgctgagtgctgacgggttcctcatgtacctctgctccccggagggc
tccatcttcaatcctcagcaccgggctctgtggcaggacatgacccagcctctctgccac
tacttcatctcctcctctcacaacacctacctgatagaggaccagatccggggtcagagc
agcatcgaaggctacatcagggctctgaaacggggctgccgctgcctggaggtggattgc
tgggacgggccgaacggggagcccatagtgtaccacggccacaccttcacctccaagatc
cccttcagggaggtggtgagcaccctggggaagtacgccttccaggcttccgacttcccg
gtgattctgtccctggagaatcactgcagcatggagcagcaggaggtgctcgcccagcag
ctgaaggacatcctgggggagcagctcctcaccgccaccaccgacgggcgcgtccccacc
cagctcccatccccggaggagctgaagcacaagatcctgctgaaggggaagaagatcggg
cggctggaggacacgctggatgggccaggggatgaggcacccgatgtgtctgatgatgac
aatggggcagaggcagaggaggagaggcggaggatgaagaaggacagggagagcctggcg
caggcgttgtctgactgcgttgtctactgcaagaatgtgtccttccggggtttccaggag
gcccgcaaccactcccggccctctgaaatctcctccctctccgaggcgaaggccaggaag
ctcatccgggatgcagggaatgagtttgtccggcacaacacctggcagctgacacgcatc
taccccagcgggatgcggacagactcctccaattacagcccccaggagatgtggaacgca
gggtgtcagatcgtggccctgaacttccagacagctggcatggagatggacctgtgtgat
gggctgttcagccagaatggtcactgtggctacgtgcttaaaccagccttcatgagggat
gaagggactctcttcaaccccagtgaccccagcacctggcagggccccggccccgtcacc
ttgacaatccaggtgatcagcgggcagcagctgcccaaagtggccaacagcaaggatgga
gccatcatcgaccccctggtgcgcgtggagatccacggggtgccggcagaccaggcacac
caggagaccaagtacatcgagaacaacggtgagcctgtggtacggggacccgctgtgcct
gtccctgccctgtcacccaccagtgcctgctctcctttaccagggtttaacccccactgg
gacgagacccttcagttccagctccacgtgccccagctggcccttgtccgctttgtggtg
gaggattatgacaagacctccaggaacgatttcgtgggacagttcaccctggcctttgcc
aacatcaaacctggctaccgccacatccatctcctctccaaggatggcaccggcatcccg
ccctcttcgctctttgtccacatccgcatcaccgagccgcctggccccgagcaagactga

DBGET integrated database retrieval system