KEGG   Gallus gallus (chicken): 424249Help
Entry
424249            CDS       T01006                                 

Gene name
PDIA5
Definition
(RefSeq) protein disulfide isomerase family A, member 5
  KO
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     424249 (PDIA5)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   424249 (PDIA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
7
AA seq 639 aa AA seqDB search
MEAAQRTVVSGQSGDRLTHYMILEVFSNLDDSTTVSPAHAGSEAEAHVTPPRGEAPRGMA
GALPQPSRGWRGGLQLPACPARPGGSGGTRVRRQTWQRQPQPAALCSAMAVPGQRAGAAR
CRGRFPLLLLGLTAFLLAFGYSLKLSPLIEKISDHKDFKKLLRTRNNVLVLYSKSAAAAE
SSLRLLSNVAQEVKGRGTISWIDCGDTESRKLCKKMKVDPNSKEKGVELLHYKDGAFHTE
YNRAVTLKSMVAFLKDPEGAPLWEEDPEAKDIVHVDSEKELRRLLKKEDKPLLMMFYAPW
CGVCKRMMPSFQQAATELKGKYVLAGMNVYSAEFERIKEEYNVRGYPTICYFEKGKFLFH
FENYGATAADIAEWLKNPQAPQPQAPEIPWADEENVVYHLTDEDFDKFIKDHSSVLVMFH
APWCGHCKKMKPEYEKAAEFLHAGSDSPGVLAAVDATVNKALAERYHISGFPTVKYFKDG
EEKYTLPHLRTKKKIIDWLQNPEAPPPPEPAWEEKQSSVVHLAGEDFRESLKKKKHTLVM
FYAPWCPHCKNAIPHFTTAAEVFKEDRKIAYAAVDCAKDQNHDLCKQEGVDGYPTFNYYN
YGKFVEKYTGERGEAGFTTFMRTLRERDHERVGKKKDEL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcacagaggactgtggtcagtgggcagagcggggacaggttgacacactac
atgattttagaggtcttttccaacctcgatgattctacgactgtaagcccagcacacgct
gggagtgaggcggaggctcatgtcacaccgccccgcggagaggcccctcgcggcatggcg
ggcgcactccctcagccctcccgggggtggcggggcggactacaactcccggcatgcccc
gcgcggccgggcgggagcggcggaacgcgcgtgcgccgccagacgtggcagcggcagccg
cagcccgcagcgctgtgctcggcgatggctgtgccggggcagcgcgcgggggctgctcgg
tgccgcggacggttcccgctgctgctgctcgggctgacggcattcctgctggcgttcggg
tactcgttgaaattgtctcctctcatagaaaaaataagcgaccacaaggattttaagaag
cttctcaggacacgaaacaacgtactagtgctgtattccaaatctgctgctgctgcggaa
agctcactcaggttactgtccaatgtggcccaggaggtgaaaggacgaggtactataagc
tggatagactgtggtgacactgaaagccgaaaattatgcaagaagatgaaagtagatcct
aattcaaaggagaaaggagtggaattactccattataaggatggtgcatttcatactgaa
tataacagagctgtcacgttgaagtctatggtggcctttctcaaggatccagagggtgct
ccattatgggaggaggatcctgaagccaaagacatcgtacatgttgacagtgaaaaggaa
ttacgaaggcttctgaagaaggaagacaaaccccttctgatgatgttctatgccccatgg
tgtggtgtttgtaagagaatgatgccatcttttcagcaggcggccacagaactgaagggt
aaatatgttcttgcaggaatgaacgtttactctgctgaatttgaaaggataaaggaagaa
tacaatgtccgtggatatcctacaatctgctattttgagaaaggaaagttcctgttccat
tttgagaactacggtgctactgcggcagatatagcagagtggctgaaaaacccgcaggca
cctcagccacaggctccggagattccctgggcagatgaggaaaatgtagtttatcacctg
accgatgaggacttcgacaagtttataaaagatcattcatctgtcctagtgatgttccat
gcgccatggtgtgggcactgtaagaagatgaagccagaatatgagaaggctgcagagttt
ctccatgcaggcagtgatagcccaggtgtccttgcagcagtagatgctaccgtcaacaaa
gcactggcagaaagataccacatctcagggtttcctactgtgaagtactttaaggatgga
gaagagaaatacactctgccacacctcagaacgaaaaagaagatcatcgattggctgcaa
aatcctgaagcaccacctccacccgagcctgcatgggaagaaaaacagagcagtgttgtc
catcttgctggagaagacttcagggagtccttgaagaagaagaagcacacccttgtcatg
ttctacgcaccgtggtgccctcactgcaaaaatgccattccacattttacgactgctgcc
gaagtctttaaagaagaccgaaagatcgcctacgctgcggtggactgtgccaaagatcag
aatcatgacctgtgcaagcaggagggagttgatggctaccccaccttcaactattacaac
tatgggaagtttgtggaaaaatatactggagagagaggggaggctggattcaccacgttc
atgcgaacccttagagaaagagaccatgagagagtaggaaagaagaaggatgaattgtaa

DBGET integrated database retrieval system