KEGG   Gallus gallus (chicken): 424249Help
Entry
424249            CDS       T01006                                 

Gene name
MIR7110, PDIA5
Definition
(RefSeq) microRNA 7110
  KO
K09583  protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     424249 (MIR7110)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   424249 (MIR7110)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    424249 (MIR7110)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 AhpC-TSA Thioredoxin_8 Redoxin OST3_OST6 Thioredoxin_6 Thioredoxin_9 TraF Thioredoxin_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 424249
NCBI-ProteinID: XP_422097
CGNC: 8884
Ensembl: ENSGALG00000011689
Position
7
AA seq 639 aa AA seqDB search
MEAAQRTVVSGQSGDRLTHYMILEVFSNLDDSTTVSPAHAGSEAEAHVTPPRGEAPRGMA
GALPQPSRGWRGGLQLPACPARPGGSGGTRVRRQTWQRQPQPAALCSAMAVPGQRAGAAR
CRGRFPLLLLGLTAFLLAFGYSLKLSPLIEKISDHKDFKKLLRTRNNVLVLYSKSAAAAE
SSLRLLSNVAQEVKGRGTISWIDCGDTESRKLCKKMKVDPNSKEKGVELLHYKDGAFHTE
YNRAVTLKSMVAFLKDPEGAPLWEEDPEAKDIVHVDSEKELRRLLKKEDKPLLMMFYAPW
CGVCKRMMPSFQQAATELKGKYVLAGMNVYSAEFERIKEEYNVRGYPTICYFEKGKFLFH
FENYGATAADIAEWLKNPQAPQPQAPEIPWADEENVVYHLTDEDFDKFIKDHSSVLVMFH
APWCGHCKKMKPEYEKAAEFLHAGSDSPGVLAAVDATVNKALAERYHISGFPTVKYFKDG
EEKYTLPHLRTKKKIIDWLQNPEAPPPPEPAWEEKQSSVVHLAGEDFRESLKKKKHTLVM
FYAPWCPHCKNAIPHFTTAAEVFKEDRKIAYAAVDCAKDQNHDLCKQEGVDGYPTFNYYN
YGKFVEKYTGERGEAGFTTFMRTLRERDHERVGKKKDEL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcacagaggactgtggtcagtgggcagagcggggacaggttgacacactac
atgattttagaggtcttttccaacctcgatgattctacgactgtaagcccagcacacgct
gggagtgaggcggaggctcatgtcacaccgccccgcggagaggcccctcgcggcatggcg
ggcgcactccctcagccctcccgggggtggcggggcggactacaactcccggcatgcccc
gcgcggccgggcgggagcggcggaacgcgcgtgcgccgccagacgtggcagcggcagccg
cagcccgcagcgctgtgctcggcgatggctgtgccggggcagcgcgcgggggctgctcgg
tgccgcggacggttcccgctgctgctgctcgggctgacggcattcctgctggcgttcggg
tactcgttgaaattgtctcctctcatagaaaaaataagcgaccacaaggattttaagaag
cttctcaggacacgaaacaacgtactagtgctgtattccaaatctgctgctgctgcggaa
agctcactcaggttactgtccaatgtggcccaggaggtgaaaggacgaggtactataagc
tggatagactgtggtgacactgaaagccgaaaattatgcaagaagatgaaagtagatcct
aattcaaaggagaaaggagtggaattactccattataaggatggtgcatttcatactgaa
tataacagagctgtcacgttgaagtctatggtggcctttctcaaggatccagagggtgct
ccattatgggaggaggatcctgaagccaaagacatcgtacatgttgacagtgaaaaggaa
ttacgaaggcttctgaagaaggaagacaaaccccttctgatgatgttctatgccccatgg
tgtggtgtttgtaagagaatgatgccatcttttcagcaggcggccacagaactgaagggt
aaatatgttcttgcaggaatgaacgtttactctgctgaatttgaaaggataaaggaagaa
tacaatgtccgtggatatcctacaatctgctattttgagaaaggaaagttcctgttccat
tttgagaactacggtgctactgcggcagatatagcagagtggctgaaaaacccgcaggca
cctcagccacaggctccggagattccctgggcagatgaggaaaatgtagtttatcacctg
accgatgaggacttcgacaagtttataaaagatcattcatctgtcctagtgatgttccat
gcgccatggtgtgggcactgtaagaagatgaagccagaatatgagaaggctgcagagttt
ctccatgcaggcagtgatagcccaggtgtccttgcagcagtagatgctaccgtcaacaaa
gcactggcagaaagataccacatctcagggtttcctactgtgaagtactttaaggatgga
gaagagaaatacactctgccacacctcagaacgaaaaagaagatcatcgattggctgcaa
aatcctgaagcaccacctccacccgagcctgcatgggaagaaaaacagagcagtgttgtc
catcttgctggagaagacttcagggagtccttgaagaagaagaagcacacccttgtcatg
ttctacgcaccgtggtgccctcactgcaaaaatgccattccacattttacgactgctgcc
gaagtctttaaagaagaccgaaagatcgcctacgctgcggtggactgtgccaaagatcag
aatcatgacctgtgcaagcaggagggagttgatggctaccccaccttcaactattacaac
tatgggaagtttgtggaaaaatatactggagagagaggggaggctggattcaccacgttc
atgcgaacccttagagaaagagaccatgagagagtaggaaagaagaaggatgaattgtaa

DBGET integrated database retrieval system