KEGG   Gallus gallus (chicken): 424261Help
Entry
424261            CDS       T01006                                 

Gene name
AMHR2
Definition
(RefSeq) anti-Mullerian hormone receptor, type II
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
AGE-RAGE signaling pathway in diabetic complications
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    424261 (AMHR2)
   04350 TGF-beta signaling pathway
    424261 (AMHR2)
   04068 FoxO signaling pathway
    424261 (AMHR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    424261 (AMHR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    424261 (AMHR2)
  Cellular community - eukaryotes
   04520 Adherens junction
    424261 (AMHR2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    424261 (AMHR2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     424261 (AMHR2)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   424261 (AMHR2)
Enzyme-linked receptors [BR:gga01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   424261 (AMHR2)
Cytokine receptors [BR:gga04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   424261 (AMHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
7
AA seq 678 aa AA seqDB search
MPAVDTRSPPQLPGLLRAAQFHSWKNQIFPEPELFPQLPPSHICIYFTRRAGLSLFMSCS
SWADPTHSWARCAWIRLPSQQPHEFGAVGLTSERKKDGWVNSLKPGFWIQKMGCRRRPGL
LSLLLLSFSCCASARRSLKTNLCKWCDSTPPACEREVCYSNCNLNSYCEDPFEICVAIWR
QDNDSIRISTLCHNPHRPIENLMVPNYNTSRCIMTHQPSEDGIIYICGCVDEQECNDKLI
FENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKQRKRAKSWVGKQGQG
PALPEPGRAAERDEKLSVLMDDGPAAMNATCANSLNHNTELLPIELDEMVGKGQFAEVWR
AKLNHSSSGQYETVAVKIFPCEEYSSWKNESQIFTDASLKHDSVLQFLTAEDRGSGPRRE
YWLITAYHSRGNLKDYLSRHILSWMDLQKMAGSLVNGVAHLHSDYTACGRPKIPIAHRDI
KSTNILVKNEQECVICDFGIAIRLDPSLTADDFANSGQVGTARYMAPEVLESRVNLEDLE
SFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLHGRGRPEI
PSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNNTDNEVGK
TASAGGEQRDNDGSRSAP
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagtagacacaaggtctcctccacagctccctgggctgctcagagcagctcaa
ttccacagttggaaaaaccaaattttcccagagccagagctcttcccccagctccccccc
tcccatatttgtatatatttcacgaggagagctgggctgagtttgttcatgagctgcagt
tcctgggcggaccccacgcacagctgggctcgctgcgcctggatccgccttcccagccag
cagcctcatgaattcggggctgtggggttgacatcggagaggaagaaggatggatgggtc
aacagcttgaaaccaggcttctggatccagaaaatgggttgccggaggagaccgggtctg
ctttccttgctgctgctgtccttctcctgctgtgccagcgcgcgccgcagcctgaagacc
aacctgtgcaagtggtgcgactccacgccgccggcctgcgagcgggaggtgtgctacagc
aactgcaacctcaactcctactgcgaggacccctttgagatctgcgtggccatatggagg
caggacaacgacagcatcaggatcagcacactctgccacaacccccaccgccccatagag
aacctcatggtccccaactacaacacctcgcgctgcatcatgacccaccagcccagcgag
gatggcatcatctacatctgtggctgcgtggatgagcaggagtgcaatgataagcttatc
ttcgaaaatcataccaatggctactccatgctgcagagcaaggaggtcatcccggtggcc
gccatcagcctcctgccgccgttgctggtggcagtgatgatcaccgtcatcttctacctc
tgccgcacacagaagcaacgcaagagggccaagagctgggttgggaagcagggacagggt
ccagcactgccagagccgggcagggctgccgagcgggacgagaagctgtctgtgctgatg
gatgatggcccggccgccatgaatgccacctgcgccaacagcctcaaccacaacaccgag
ctgctgcccatcgagctggacgagatggtaggcaaggggcagtttgcggaggtgtggagg
gctaagctgaaccacagcagctcagggcagtacgagacggtggcggtgaagatctttccc
tgtgaggagtattcttcctggaagaacgagagccagatcttcacggacgccagcctcaag
catgacagtgtcctgcaattcctcacggctgaggacaggggttcggggccacgcagagag
tactggctcatcaccgcctaccacagcaggggcaacctcaaggactatctctccagacac
atcctgagctggatggacctgcaaaaaatggcggggtcgctggtgaacggggtggcccac
ctccacagcgattacaccgcctgcggccggccgaaaatccccattgcccaccgggacatc
aaaagcaccaacatcctggtgaagaacgagcaggagtgcgtgatctgtgacttcggcatt
gccatacgccttgacccctcactgacggcagatgactttgctaacagcgggcaagtgggc
actgccaggtacatggctccagaggtcctggagtccagggtgaacctggaagatctggag
tctttcaagcagatggacgtctactccatggcccttgttctgtgggagatggcctccaga
tgtgaagtggtgggagaggtaaagaattacgagctgccttttgggtcaaaagtgcaggag
cagccctgtgtggacaccatgagagacatcgtgctgcatggcagagggcggcctgagatc
cctagcagctggctggtgcaccaggggatgcgcttcctgtgcgacaccatcacggagtgc
tgggaccacgaccccgaggctcgcctcaccgcacactgcgtggccgagcgcttcaacctg
atggcgcagatggattgcgacgacatcctcaacaacaacacggacaacgaggtcggcaaa
acagcctctgcgggcggggagcagcgggacaacgacgggagcaggagtgcgccgtga

DBGET integrated database retrieval system