KEGG   Gallus gallus (chicken): 424359Help
Entry
424359            CDS       T01006                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     424359 (UCHL5)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   424359 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 297 aa AA seqDB search
MAGGSSAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPIHGLIFLFKW
QPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIRLGETLSEFKEFS
QSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYEL
DGLREGPIDLGSCNQDDWISAVRPVIEKRIQKEEPMETDQSSNMLSSIQSEVAKYQMLIE
EENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKVQEAK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaggcagcagcgccggggagtggtgtctcatggagagcgacccgggcgtcttc
acggaactcatcaagggcttcggctgtagaggagcacaagtagaagaaatatggagttta
gaaccggaaaactttgaaaaattgaagccgatacatgggctgatattccttttcaagtgg
cagccaggagaggaaccagcaggttctgttgttcaggattccaggctggatacaatattt
tttgctaaacaggtgataaataatgcttgtgctactcaagccatagtaagtgtgttgttg
aattgcgctcatcaagatatccgtctaggagagactttgtcagaatttaaggagttttca
cagagttttgatgctgcgatgaaaggcttggcactaagcaactcagaagtgattcgacaa
gttcacaacagctttgccagacagcagatgtttgagtttgatgccaagtcttcagcaaaa
gaagaagacgcgtttcacttcgtaagctatgttcctgttaacggacggctgtatgaactg
gatggattaagggaaggaccaattgatttaggttcatgcaatcaagatgactggattagt
gctgtgcggcctgtcatagagaaacggatacaaaaagaggaacctatggagaccgatcaa
agtagtaacatgttaagttctatacagtcagaagttgcaaaatatcagatgttaattgaa
gaagagaaccaaaaactaaaaagatacaagattgaaaacattagaagaaaacataactac
ctgcctttcatcatggaattattaaagactctagcagaacatcaacagttaataccatta
gtagaaaaagctaaagaaaaacagaacgccaagaaagttcaggaggccaagtga

DBGET integrated database retrieval system