KEGG   Gallus gallus (chicken): 424377Help
Entry
424377            CDS       T01006                                 

Gene name
SEC22B, SEC22L1
Definition
(RefSeq) SEC22 homolog B, vesicle trafficking protein
  KO
K08517  
vesicle transport protein SEC22
Organism
gga  Gallus gallus (chicken)
Pathway
SNARE interactions in vesicular transport
Phagosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    424377 (SEC22B)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    424377 (SEC22B)
Membrane trafficking [BR:gga04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    424377 (SEC22B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 215 aa AA seqDB search
MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMA
FHYIIEKGVCYLVLCEAAFPKKLAFAYLEDLQSEFDEQHGKKVPTVSRPYSFIEFDTYIQ
KTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKY
RQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcttaccatgatcgcccgcgtggcggacggactgccgctcgctgcctccatg
caggaggatgagcagtccggccgcgacctgcagcagtaccagagccaggcgaagcagctg
ttccgcaagctgaacgagcagtcccctacgaggtgcactctggaggcaggagccatggct
ttccactacatcattgagaaaggggtgtgttacctggtcctgtgcgaagctgcgttcccg
aagaaactggcctttgcatatctggaagacttgcaatcagaatttgatgagcagcatggc
aagaaggtgccgacggtttccaggccctattccttcattgaattcgacacctacatccag
aaaaccaagaagctctacatcgacagccgggcgaggaggaacctgggttccatcaacaca
gagctgcaggatgtgcagaggattatggtggccaacattgaggaagtcttacagcgagga
gaggcactttcagctctggattccaaggccaacaacttgtccagtttgtccaagaagtac
cgtcaggatgcaaagtacctgaacatgcgttccacttacgccaaactcgcggctgtagct
gtgttttttatcatgttgatcgtctatgtgagattctggtggctgtga

DBGET integrated database retrieval system