KEGG   Gallus gallus (chicken): 424442Help
Entry
424442            CDS       T01006                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    424442 (LAMC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    424442 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 424442
NCBI-ProteinID: XP_001234659
CGNC: 3417
Ensembl: ENSGALG00000004620
UniProt: F1NI05
Position
8
AA seq 1603 aa AA seqDB search
MGGVGGRRALLRVLALLAVLALPRGGGAAMDECTEERSGRPQRCMPEFVNAAFNATVVAT
NTCGTPAEEYCVQTGVTGVTQSCHLCDASQPHLRHGASFLTDYNSQADSTWWQSQSMLAG
VQHPAAVNLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWVPYQYYSGSCESTY
NKVNRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTA
TDIRVSLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECIRNELGKLVCN
CKHNTFGDDCEKCLPFFNDRPWRRATAESANECLPCDCNGRSQECYFDPELYRSTGHGGH
CMGCRDNTDGAHCERCRDSFYRLGSEEGCLPCSCNPVGSLSTQCDSYGQCSCKPGVMGEK
CDRCQPGFHSLSEAGCRPCSCNPAGSTGECNMETGRCTCKDNVEGFHCERCKPGFFHLDP
SNPRGCTPCFCFGHSSVCTNAIGYSVYSITSSFQFGEDEWHAEQRDGSQVPLQWSSETQD
ISVISDSYFPIYFVAPRKFLGNQVLSYGQNLTFSFRVDRRDTRLSAEDLVLEGAGLRVSV
PLIAQGNSYPSESPLTYTFRLHEAADYPWRPALSAFDFQKLLHNLTAIKIRGTYSERSAG
HLDDVTITSAVPGAGVPAAWVESCSCPAGYEGQFCERCSPGYRRETPGLGPYSPCVPCTC
NGHSETCDPETGMCDCRDNTAGSHCEKCSDGYYGDATAGTALDCQPCPCPGGSSCAVVPR
TKEVVCTSCQTGTTGKRCELCDDAYFGDPLGENGAVRPCRLCQCNDNIDPNAVGNCNRQT
GECLKCIYNTAGFYCDRCKDGFFGNPLATNPADKCRACHCNPYGTVNQQTSCNQVTGQCE
CLSHVTERDCSACEPGFFNLQSGRGCERCDCHALGSTNGQCDIWTGQCECQPGVTGQRCD
RCEANHFGFGPEGCKPCDCDPEGSRALQCREDGRCECKEGFVGSRCDQCEENYFYNRSWP
GCQECPACYRLVKDKVAEQRERLRELENLIANLGTGEETITDQAFEERLKQAERDVMELL
REAQNSKDVDQGLMDRLRDINSTLTSQLSRLRNIQNTVQETENLAEQARGRVEDTEDLIA
MASDMLEKAKMAAGNVSITPPESSSDPNNMTLLAEEARRLAERHKQEADEIVRIAKAAND
TSTEAYQLLLKTLAGENQTARDIDELNQKYNQARNISRDLERQANRVLEEAEEAGNKALQ
IYANLTNLPTVDTTGLENEANKIKKEAEELDQLIARKLKDYEDLREDMKGKELEVKNLLE
KGKTEQQTADQLLARADAAKALAEEAARKGNGTLQEANTILSNLKDFDKRVNDNKTAAEE
ALKKIPAITQTIAEANNKTRQAELALGNAAADAREAKTRADDAEKIASAVQKSAAATRAE
ADKTFSDVTGLAREVDDMMKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEDNARKA
KNSVNSLLAVINDLLDQLGQLETVDLNKLNEIEGTLNSAKDQMKDSDLDQKVAFLEREAR
KQDDAIQSYNRDIEEILKDISNLEDIRKTLPSGCFNTPSIEKP
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgttggcgggcggcgggcgctgctgcgggtgctggcgctgctggccgtgctg
gcgctgccccgcggcggcggcgcggcgatggacgagtgcacggaggagcggagcgggcgg
ccgcagcgctgcatgcccgagttcgtcaacgccgctttcaacgccacggtggtggccacc
aacacgtgcggcacgccggccgaggagtactgcgtgcagaccggcgtcaccggcgtaacc
cagtcgtgccacctgtgcgacgcctcccagccccacctgcggcacggcgcctccttcctc
accgactacaacagccaggccgacagcacctggtggcagagccagagcatgctggccggc
gtgcagcaccccgccgccgtcaacctcaccctgcacctcggaaaggcctttgacatcacc
tacgtgcggctgaagttccacaccagccggccagagagcttcgccatctacaaacgcacg
cgggaggatggcccgtgggtgccctaccagtattacagcgggtcgtgtgagagcacctac
aacaaagtcaaccggggctttattcggactggggaggacgagcagcaggcgctgtgcacg
gatgagttcagtgacatctcccccctcactgggggcaacgtggctttctcaacgttggag
gggcgtcccagcgcctacaactttgacaacagccccgtgctgcaggaatgggtgacggcc
accgatattagggtgagcctcaaccgcctcaacaccttcggagatgaagttttcaatgac
cccaaagtcctcaagtcgtattactacgcgatttctgattttgccgtgggtggaagatgc
aaatgcaatggccatgcgagcgagtgcataaggaacgagcttgggaagctggtctgcaac
tgcaagcacaacacctttggggatgactgtgagaagtgccttcccttcttcaatgaccgg
ccgtggaggagagcaacagcagaaagtgccaacgagtgcttgccttgtgactgcaatggg
aggtcacaggagtgctacttcgaccccgagctgtaccgctccaccggccacggcgggcac
tgcatgggctgccgggacaacaccgacggcgcccactgcgagaggtgcagggacagcttc
taccgcctcgggagcgaggagggctgcctgccctgcagctgcaaccccgtgggctctctc
agcacacagtgtgatagctacggccagtgcagctgcaagcctggtgtcatgggggagaaa
tgtgaccgctgccagccaggcttccactctctctctgaggctgggtgcaggccctgttct
tgcaatcctgctggcagcacaggtgaatgcaacatggaaacaggacggtgtacttgcaag
gacaacgttgagggcttccactgtgagagatgcaaacctgggtttttccatctggatccc
tcaaatccaagaggctgtaccccctgcttctgttttggacactcttcggtttgcaccaat
gccattggctacagcgtgtacagcatcacctccagctttcagtttggagaggacgagtgg
cacgctgagcaacgtgacggctcccaggtccctctgcagtggagttcagagacccaggac
atctctgtcatctcagacagctacttccccatctattttgttgcaccacgcaaattcttg
ggcaaccaagttttgagctacggtcagaacctgaccttctccttccgtgtggacagacgg
gacacacgtctctcagcagaggacctggtactggaaggggccgggctgcgtgtgtcggtg
cctctcattgcccagggcaactcgtaccccagtgagagcccactgacctacaccttcagg
ctccatgaggctgctgattacccgtggaggcctgctctctctgcatttgacttccagaag
cttctccacaatttgactgccatcaagatccgtggaacatacagcgagagaagtgccggc
catctggatgacgttaccatcaccagtgctgtcccaggggccggcgtgcccgcagcgtgg
gtggagagctgctcctgtccagcaggctacgaggggcagttctgtgagcgctgctcccct
gggtaccgccgagaaacccccggcctggggccctacagcccctgcgtgccttgcacctgc
aatgggcacagcgagacctgtgatcctgagacgggcatgtgcgactgcagggataacacg
gcaggctctcactgcgagaagtgcagcgatgggtactacggggatgcgacagcgggcaca
gccttggactgccagccctgcccctgccccggcggctccagctgtgccgtcgtgccccgc
acaaaggaggttgtgtgcaccagctgccagacaggcaccaccggcaagaggtgtgagctg
tgtgatgatgcctattttggagacccactgggtgaaaatggggctgtgaggccgtgccgc
ctgtgccagtgcaacgacaacattgatcccaacgctgtgggcaactgcaaccggcagacg
ggggagtgcctcaagtgcatctacaacacagccggcttctactgcgaccgctgcaaggac
ggcttctttgggaaccccctggccaccaaccctgctgacaagtgccgggcttgtcactgt
aatccctacggcaccgtgaatcagcagacgagctgcaaccaagtgacggggcagtgcgag
tgcctctcccacgtcaccgagagggactgcagcgcctgcgagcccggcttcttcaacctg
cagagcggccgaggctgtgagaggtgtgactgccacgcgctgggctccaccaatggccaa
tgtgacatatggacagggcagtgtgagtgccagcccggcgtcaccggccagcgctgcgac
cgctgcgaggccaaccactttggattcggccctgagggctgcaaaccatgcgactgtgac
ccagagggctcacgtgccctgcagtgccgtgaggatgggcgctgtgagtgcaaggagggc
tttgtggggagccgctgcgaccagtgtgaggagaactacttctacaacaggtcgtggccg
ggctgccaggagtgccctgcgtgttacagattagtgaaagataaggtggcagagcaacga
gagaggctacgggagctggaaaacctgatagcaaatctgggcacaggagaagaaactatc
actgatcaagccttcgaggagaggttgaagcaggcagaaagagatgttatggagctgctc
cgagaagcacagaacagcaaagacgtagatcagggtctcatggatcgtctcagagacatc
aacagcactttgacaagtcagctcagcaggctgaggaacatccagaacacggtgcaggag
acagagaacctggcagagcaagcccggggccgggtggaggacacagaggacctgattgca
atggcttctgatatgctggagaaggcaaagatggcagctggcaacgtgtccattacaccc
ccggagtcgagcagtgaccccaacaacatgactctattggcagaagaggcgcgccggctg
gctgagaggcacaaacaagaagctgatgagatcgttcgcattgccaaggcagccaacgat
acttccacagaagcgtatcagctgctgctgaagaccctggctggggaaaaccaaacagca
cgtgacattgatgagctcaaccagaaatataaccaagcaagaaacatttctcgagatcta
gagagacaggccaaccgtgtgcttgaggaggcagaggaagctggaaataaggccctccag
atctatgctaatctcaccaatctgcccactgtggacaccacggggctggagaatgaagca
aataagatcaagaaggaagcagaggagttagatcagttaatagcaaggaagttgaaggac
tatgaagacttgagggaagacatgaagggaaaggagctggaagtcaagaacctcttggag
aaagggaagacggagcagcagactgcagaccagctcttggctcgagcagatgcagcaaaa
gccctggctgaggaagctgctcggaagggcaatggcacactgcaggaggccaacaccatt
ctcagcaacctgaaagatttcgataagcgggtgaacgacaacaagacagcagctgaggag
gcgctgaagaagatccctgccattacccagaccattgctgaagccaacaacaagacccgc
caggcagagctggcgcttggcaacgctgctgctgatgcccgtgaagccaaaactagagca
gatgatgctgagaaaattgccagcgctgttcagaagagtgccgctgctaccagagcagaa
gcggacaagaccttctctgacgtgacggggctggccagagaggtggatgacatgatgaag
cagctccaggaggctgaaaaagagctgaagcgtaaacaagatgatgctgatcaagatatg
atgatggcaggcatggcctcacaggcagcccaggaggcagaagacaacgcaagaaaagcg
aaaaactctgtgaacagcttgcttgctgtcattaatgaccttttagaccaactagggcaa
ctggagacggtggacctgaacaaactgaatgagattgagggtaccctgaacagtgccaaa
gaccagatgaaagatagcgacctggaccagaaggtagctttccttgagagagaagccagg
aagcaagatgatgcgatacagtcctacaacagggacattgaggaaatcctgaaagacatt
agcaacctggaggacatcaggaagaccttgccatctggctgctttaacaccccgtccatt
gagaaaccctaa

DBGET integrated database retrieval system