KEGG   Gallus gallus (chicken): 424474Help
Entry
424474            CDS       T01006                                 

Gene name
AGL
Definition
(RefSeq) amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
8
AA seq 1530 aa AA seqDB search
MPSHKETRLLHLNEMEKLDKTLFRLEQGFELQFRLGPTLQGKHVTVCTNYPASGEVFDRH
KFRTLSWHNPTGKEDDSDKYCKLDLQISGSYQYYFNLGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFHEWENRLKVAKETGYNMIHFTPLQKLGLSRSCYSLADQLE
VNPEFSSHNKKCTWNDIGALVEKMKNEWNMLCITDVVYNHTAANSEWLRMHPECGYNLVN
SPHLKPAWVLDRALWHLSCMVADGRCIDKGVPPLIENDHHLNCIRKIIWEDIYPKIKLWE
FFQVDVNKAVQQFRTLLTKGKIGTKSDPNQHLQIVQDPDYRRFGCTVDMNIALATFIPHS
NGPGAIEECCNWFRKRIEELNAEQYRHIHHHQEQAVNCLAGTVVYERLAGHGPKLGPISR
KYPLVTRYFTYPFKDLTVEEEQSMMHQPDKACYFMAHNGWVMGDDPLRNFAEPGSNVYLR
RELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITAKHFHGVRLDNCHSTPIHVAEEMLA
TARSVRPNLYVIAELFTGSEYIDNVFVNRLGITSLIREAMTAYNSHEEGRLVYRFGGEPV
GSFVQPRLRPLVPAIAHALFMDITHDNECPIQHRSAYDALPSAMIVSMACCATGSTKGYD
ELVPHQISVVSEERFYSTWNPQAHLNSGEVNFQTGILAGRLAMNRLHQELGTKGFNQVYV
DQVDEDIVAVTRHCPNTHQSVVAVSRTAFRDPKTSFYSKEVPEMCIPGKIEEVVFEARTI
ERSVSPYTKDEHFINGLPNFTVELREHIQIKDSKIIKQAGTAIKGPNEFVQEIEFENLTP
GSVIVFRVSLDPKAQEAVGVLRNHLIQFSPHFKSGSLPDDHSAPILKTLFSSIASKLTLA
DLNQVLYRCESEEQEDGGGCYNIPNWSSLKYAGLQGLMSVMADIRPKNDLGHPFCDNLRS
GDWMIDYVSNRLISRAGACAEVGKWLKAMFVYLKKIPRYLIPCYFDAILVGAYTTLLDVG
WHQMSSFVQNGSTFVKHLSLGSIQMCGIGKYACLPDLSPSLHDVPYRLNEITHEKEQCCV
TLAAGLPHFSSGIFRSWGRDTFIALRGLMLLTGRYIEARNIILAFGGTLRHGLIPNLLGQ
GTHARYNCRDAVWWWLQCIQDYCKIVPNGLDILRCPVSRMYPRDDSAPQPAGSVDQPLYE
VIQEAMQRHMEGINFRERNAGPQIDQNMRDEGFNIIAGIDRETGFVFGGNRFNCGTWMDK
MGESDRARNKGIPATPRDGSAVEIVGLCKSAVRWLLDLSRKNEYPFHGVTIKRYGREETI
TYDEWNRKIQGHFERLFFVSENPADQNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPNFT
IAMVVAPELFTPERAWKALRIAEEKLLGPLGMKTLDPDDMVYCGIYDNALDNDNYNVARG
FNYHQGPEWLWPIGYFLRAKLYFSKLIGPEIYAKTVVMIKNVLSRHYVHLERSSWKGLPE
LTNENGQYCPFSCETQAWSIGVILEVLYDL
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atgccgagccataaggagacgcggctgctgcacctcaacgagatggagaagctggacaag
acccttttcaggctggagcaagggtttgaactgcagtttcgactgggcccaactcttcaa
ggcaagcatgttactgtatgtacaaattatccagcttctggagaagtatttgatcgccac
aagttcagaacattatcatggcacaatcccacaggaaaagaggatgactctgacaaatat
tgcaagttagatctccaaatttctgggtcgtatcagtactattttaatcttggaaatgag
aaaagtggtggaggttacatagttgtggatcctattttgcgtgttggagccgataaccat
gtattacctttggactgtgttacactccagacattccttgctaaatgtctgggaccattc
cacgaatgggaaaataggcttaaagttgcaaaagaaacaggttacaacatgattcatttt
acaccgctgcagaagcttggactgtctagatcatgttattcactggctgatcagttagaa
gtaaatcctgaattttcaagccataacaaaaaatgcacttggaatgatataggagctctt
gtggaaaaaatgaaaaatgaatggaatatgctttgcatcacagatgtagtctacaatcat
actgctgctaacagcgagtggctcaggatgcatccagaatgtggctacaaccttgtaaat
tctcctcacctgaagccagcctgggtcttagatagagctctgtggcacctgagctgtatg
gtggctgatggaaggtgtattgataaaggagtccctcccttgattgaaaatgatcatcac
ctgaattgtatccgtaaaatcatttgggaagatatatatccaaaaatcaaactgtgggaa
tttttccaagtagatgttaataaagctgtgcagcaatttagaacccttctaactaaaggc
aaaataggcacaaagtctgatccaaatcaacatcttcaaatagttcaagaccctgattat
agaagatttggttgtactgtagatatgaatatagcattggcaacattcataccacacagc
aacggaccaggtgcaatagaagaatgttgtaactggtttcgcaagagaattgaggaactg
aatgctgaacaatacagacatattcatcatcatcaagagcaggctgtcaactgtcttgca
ggaactgtggtatatgaacgtctggctggtcatggtcctaaactaggtcctattagtaga
aaatatcctctagttaccaggtattttacttatccattcaaagacctgactgtggaggaa
gaacaaagtatgatgcatcagccagataaagcttgttatttcatggcccataacggatgg
gttatgggtgatgatcctcttagaaactttgcagaaccaggttcaaatgtttacttgaga
agggagcttatttgttggggagacagtgtgaaactgcgctatggtaacaaacccgaagac
tgcccgtacctctgggcacatatgaaaaaatacactgaaatcactgccaaacatttccat
ggtgtccgtcttgacaactgtcactcaacacctattcatgtagctgaggagatgctagcc
acagccagatcagtcagacctaatctttatgtgatagctgaactcttcacgggcagtgag
tatattgacaatgtttttgtcaaccgtctgggaattaccagcctgattagagaggccatg
acagcttataatagccatgaagagggaaggttagtttatcgttttggaggtgaacctgtt
ggctcttttgttcagccacgtttgcggcccttggtgccagcaatagcgcatgcgctgttc
atggatattacacatgacaatgagtgtccaattcagcaccgatctgcatatgatgcactt
ccaagtgcaatgattgtttccatggcatgttgtgctacaggaagcaccaaaggttatgat
gaactagtaccacaccagatttctgtagtatctgaagagagattttattcaacctggaat
ccacaagcacacctgaattctggtgaagttaatttccagacaggaattctagctggaagg
ctagccatgaacaggctgcatcaggagctgggaactaaaggcttcaatcaggtgtatgta
gatcaagttgatgaagatatagtggcagtgacaagacattgccctaacacacaccagtct
gttgtggctgtaagtagaactgctttcagggatccaaagacttccttctacagtaaagaa
gtacctgaaatgtgtatcccaggaaaaattgaagaagtagtatttgaggctagaactatt
gagagaagtgttagtccttacacaaaagatgaacattttataaatggattgcctaatttc
acagtggaactcagagagcatatccagattaaagacagtaaaattataaagcaagctgga
actgccataaaagggccaaatgaatttgttcaagaaatagaatttgaaaatttaacacca
ggaagtgtaatagtattcagagttagtcttgatccaaaggcacaagaggctgttggtgta
cttcgcaatcatctgattcagttcagtcctcatttcaaatctgggagtcttcctgatgat
cattcagcacctatattaaaaacattattttcctcaattgcatctaaactaactttggct
gacttaaatcaagtgctgtataggtgtgagtcagaagaacaagaagatggtggaggttgt
tacaatataccaaactggtcatccctgaagtatgcaggcctccaagggttaatgtcagtg
atggcagacattagaccaaagaatgatttgggacatccgttctgtgataatttaagatct
ggagactggatgattgattatgtcagtaatcgtctgatttcacgtgcaggagcctgtgca
gaagttggcaaatggttgaaggccatgtttgtgtatttaaagaaaattccacgttacctt
attccttgttactttgatgccattttagtgggtgcatacacaactcttctggatgtggga
tggcatcagatgtctagctttgttcagaatggatcaacatttgttaaacacctttccttg
ggctcaatccagatgtgtgggataggaaaatatgcgtgtctgccagatctgtctccttcc
ttacacgatgttccctataggctgaatgagattacgcatgagaaagaacagtgctgtgtt
actttagcagctggtttacctcacttctcttctggaatattccgttcctggggaagggat
acctttattgcacttagaggcctaatgttacttacgggacgttatatagaagcaagaaac
ataattctagcgtttggtgggactctacgacatggtctcattcccaacctgcttggccag
ggaacgcatgccagatataattgtcgtgatgctgtgtggtggtggcttcagtgtatccag
gactactgtaagattgttccaaatggattagacattcttaggtgtcctgtttctaggatg
tacccaagagatgattctgctcctcagcctgcaggcagtgtggatcagccactctatgaa
gtaatacaggaggcaatgcaacgacacatggaaggcataaatttcagagaaagaaatgct
ggtccacagatagatcaaaacatgagagacgaaggttttaatataatagcaggcattgac
cgtgaaactggctttgtctttggagggaaccgcttcaattgcggcacttggatggataaa
atgggagagagtgacagagctcgcaacaagggaattcctgctacgccaagagatggctct
gctgtggaaattgttggcttgtgcaagtcggctgttcgctggttgctggatttatctagg
aaaaatgaatacccattccatggtgtcaccataaaaagatacggaagggaggaaactatc
acatatgatgaatggaatagaaaaattcaaggacactttgaaagactcttctttgtctct
gagaaccctgcagatcaaaatgaaaaacatccaaatctagttcacaaacgtgggatttat
aaagacagctatggagcttcaagtccatggtgtgattaccaactcaggccaaatttcaca
atagcaatggttgtggcccctgagttgttcacacctgagagagcttggaaagctctgagg
atagcagaggaaaaactacttggtccattgggcatgaaaactttagatccagatgatatg
gtgtactgtggcatatatgataacgctcttgacaatgacaactataatgttgccagaggt
tttaattaccaccaaggacctgaatggctgtggccgatcggatattttcttcgtgccaaa
ttgtacttctcaaagttgattggtccagagatatatgcaaaaactgtagttatgataaag
aatgttctttctcgccactatgttcaccttgaaagatcatcctggaaagggcttccagaa
ctgaccaatgaaaatgggcagtattgtccttttagctgtgaaactcaggcctggtcgatt
ggtgttatccttgaagttctttatgacttatag

DBGET integrated database retrieval system