KEGG   Gallus gallus (chicken): 424542Help
Entry
424542            CDS       T01006                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase, cAMP-dependent, catalytic, beta
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    424542 (PRKACB)
   04310 Wnt signaling pathway
    424542 (PRKACB)
   04340 Hedgehog signaling pathway
    424542 (PRKACB)
   04020 Calcium signaling pathway
    424542 (PRKACB)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    424542 (PRKACB)
  Cellular commiunity
   04540 Gap junction
    424542 (PRKACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    424542 (PRKACB)
   04912 GnRH signaling pathway
    424542 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    424542 (PRKACB)
   04916 Melanogenesis
    424542 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    424542 (PRKACB)
   04270 Vascular smooth muscle contraction
    424542 (PRKACB)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     424542 (PRKACB)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   424542 (PRKACB)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     424542 (PRKACB)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    424542 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
8
AA seq 338 aa AA seqDB search
MNVKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccacctcagaatactgctggcctagatgattttgagaggcaaaaaactcttggaacagga
tcattcggaagagttatgatggtgaagcataaagccacagaacagtattatgccatgaag
atactggacaaacaaaaggttgtcaaactgaagcagatagaacacacactgaatgaaaag
agaatattacaagcagtgaactttcctttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgaaatgttctcacatcta
agaagaattggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctacgaaatggca
gctggatatcccccattctttgcagatcaacccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaaa
aaccacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system