KEGG   Gallus gallus (chicken): 424571Help
Entry
424571            CDS       T01006                                 

Gene name
KDM4A, JMJD2A
Definition
(RefSeq) lysine demethylase 4A
  KO
K06709  
jumonji domain-containing protein 2 [EC:1.14.11.-]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     424571 (KDM4A)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    424571 (KDM4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Position
8
AA seq 1058 aa AA seqDB search
MASELESLNPSARIMTFRPTMEQFRDFSRYIAYVEAQGAHRAGLAKIVPPKEWKPRKCYD
DIDELVIPAPIQQVVTGQSGLFTQYNIQKKAMTVREFRRIANSDKYCTPRYTDFEDLERK
YWKNLTFNAPIYGADVNGTLYDKHVDAWNIGRLNTILDVVENESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSIPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPSILKKYGIPFDKVTQEAGEFMITFPYSYHAGFNHGFNCAESTNFATLRWIEYG
KQSVLCSCRKDMVKISMDVFVRKYQPDRYKLWKAGKDVTVIDHALPTPEAAEFLKGDLMQ
KVKSGRQYAEDMETGEACKEEVDGDETKSVPKHRIGTKRHRVCLEVPQEVSESEAFPKEE
LSSMQDEEDAAEPCERATGEVTQQSEQGHKVPDRVGMAKSEELKVVKLEEEEEEEQEAAV
LDLSISHASNSASVLPTSKQRAPSSVQPSSPAYSGSSDSESTDLLPKRTLPGPAGVLTVH
SYARGDASGSDNETSGKKASATGSVNEQELAEVTKEYIQSMKESKKSKGRRQPLSKLPRH
HPLLVKDCISDDEASEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEYNRTMAQQSP
YCAVCMLFQTYQAECGGSSQNSGGTPGAADGKIRTKPLIPEMCFTTTGCSTDLNLSTPYL
EEDGTSVLITCRNCQVCVHASCYGVSPDKATEDWMCSRCTENALEEDCCLCSLRGGALQR
ANDDKWVHVMCAVGVLEAKFVNIAERSPVDVSKIPLQRFRLKCIFCKKRRKRIAGCCVQC
SHGRCPTSFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPSQAERAKAALQDLSPGQIVI
SKHKNGRFYQCEVVSLAKETFYEVNFDDGSFSDNLYPEDIVSRDCLQLGPPAEGEVVQVR
WTDGQVYGAKFVASHAIQMYQVEFEDGSQLMVKRDDVYTLEEELPKRVKSRLSIASDMRF
TEIFAEKEVRQERKRQRVINSRYREDYIEPALYRAIME
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggagctggagagcctcaaccccagcgcgcgcatcatgaccttccgtcccacc
atggagcagttccgggacttcagccgctacatcgcttacgtggaggcgcagggagcgcac
cgcgccgggctggccaagatcgtgccccccaaggagtggaagccgcggaagtgctacgac
gacatcgacgagctggtgatccccgcacccatccagcaggtggtgaccgggcagtccggg
ctcttcacgcagtacaacatccagaagaaggccatgacggtgcgcgagttccgccggatc
gccaacagcgacaagtactgcacaccccgctacacagacttcgaagaccttgaacgaaag
tactggaagaaccttacgttcaatgcccccatctatggtgctgatgttaatggcacgctt
tatgacaagcacgtggatgcgtggaatattggcagattgaacacgatcctggatgttgtg
gagaatgagagcggcataaccattgaaggagtgaatactccttacctctattttggcatg
tggaaaacttcatttgcttggcatactgaggacatggatctctacagtattaattacctg
cattttggggagcctaagtcatggtactctatccctccagagcatggcaagcgactggag
agacttgccaaaggattctttccgggaagcgcccagagctgcgaagcgtttctccgtcac
aagatgaccttgatctctccatcaattctgaagaaatatggcatcccatttgataaggtg
acgcaggaggcaggagagttcatgataacttttccttatagttatcatgctggctttaat
catggatttaactgtgctgaatccaccaactttgccactcttcggtggattgagtatggg
aagcagtctgtactgtgctcgtgtcggaaggacatggtgaagatctccatggatgtgttt
gtgaggaagtaccagccagaccgttacaagctttggaaagctgggaaggatgtgactgtc
attgaccatgctcttccaacaccagaagcagctgagttccttaaaggggatctcatgcaa
aaggtcaagagtgggaggcaatatgctgaggatatggaaacaggagaagcatgtaaagag
gaagtggacggggatgagacaaaaagtgtgcccaagcatcgcataggaacaaaaaggcac
agagtgtgcctggaagtacctcaggaagtgagtgagagtgaggccttccccaaagaggag
ctgagctctatgcaggacgaagaagatgctgcagaaccctgcgagagagctacgggagaa
gttacgcagcagagtgaacaggggcacaaggttccagatcgtgtgggcatggctaaatct
gaagaactgaaagtggtgaagcttgaggaggaagaagaggaagagcaagaggccgccgtg
ttggatctttccatttcgcatgcttcaaattctgcttcagttttgccaacctcaaagcag
agagcaccttccagtgttcagcccagctcaccagcatattctgggtcttcagactctgag
tcaactgatctgttgccaaaaagaactctacctgggccagctggggtgcttacagtccat
agctatgctagaggggacgccagcggatctgacaatgaaacttcaggaaagaaagccagt
gctacaggcagcgtgaatgaacaagaactggcagaggtaacaaaggagtacatacaatca
atgaaggaaagtaagaagtccaagggtcgtcgccagccattgagtaagctcccacgccac
cacccactcttggttaaagactgcattagtgatgatgaggcatcagagcaactaactcct
gaagaagaagctgaggagacagaagcttgggccaagccacttagccagctctggcagaat
cgaccaccaaattttgaggctgaaaaagagtataatcggaccatggctcagcagtctcct
tactgtgctgtttgcatgctcttccagacgtatcaggcagagtgtggaggcagcagtcag
aactctggaggaactccgggtgccgcggatgggaagatccgaaccaagcccctgattcct
gaaatgtgctttactacaactggctgcagcactgatctcaatctttcaaccccttactta
gaggaagatggaaccagcgtactcatcacctgcaggaactgccaagtctgtgttcatgca
agttgttacggtgtatcccctgacaaggccaccgaagactggatgtgctccaggtgtaca
gaaaatgccttagaagaggactgctgtttgtgttcattacgaggaggagcactgcagaga
gccaacgatgacaaatgggttcacgtcatgtgtgctgtaggtgtactggaagcaaaattt
gtgaacattgcagaacgcagccctgtggatgtcagcaagatccccctgcaacgcttcaga
ctgaaatgcatcttctgcaaaaaacgaaggaagagaatcgcaggttgctgtgtacagtgc
tcccatggtcggtgtcccacgtccttccatgtcagctgtgcccaagcagcaggagttatg
atgcagcctgatgactggccatttgttgtcttcattacctgcttcaggcataagatccca
tctcaggcagagcgagctaaggctgcactccaagatctgtcacctgggcagatagtcatc
agcaagcacaagaatggtcgcttctatcaatgtgaagtggtcagcctcgcaaaagagact
ttctacgaggtcaactttgatgatggttccttcagtgataacctgtatccagaggacatt
gtgagtcgagactgtcttcagttgggtccaccagctgaaggtgaagttgtgcaggtcaga
tggacagatggacaggtttacggagccaagttcgttgcatcacatgccatccagatgtac
caggtggaatttgaggatgggtcacagctgatggtgaaaagggatgatgtgtacactttg
gaagaggagcttcctaagagagtcaagtcaaggctgtcaatagcttcagatatgcgcttc
acagagatcttcgcagagaaggaggtcaggcaagagaggaagagacaaagagtgatcaat
tcacgctaccgggaagattacattgaacctgccttgtaccgggccatcatggagtaa

DBGET integrated database retrieval system