KEGG   Gallus gallus (chicken): 424618Help
Entry
424618            CDS       T01006                                 

Gene name
CYP4B1
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     424618 (CYP4B1)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP4 family
   424618 (CYP4B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 504 aa AA seqDB search
MVSLLDNIARPSAVILQLSVVLGVIFVLLKVVRFYQGRKKILKALEAFPGPPAHWLYGHN
HLITGDKVLNLLVSLGEEYPYAFPRWFGPVLPSLVVHHPEYAKTILGRGDPKPPVPYQFL
VPWIGKGLLVLSGTKWFQHRKLLTPAFHYDVLKSYVSLMSDSVKVMLDKWEKKKSVELFE
DVSLMALDSIMKCAFSYNANCQTQSNSDTYIKAVFDLGYLINKRIQNFSYQDAFYDLTHS
SREFQDACRRAHAHTDKVIQERKILLSNDKELDKIRKKRHLDFLDILLCTKDENGVGLSD
EDLRAEVDTFMFEGHDTTASGISWLLYCMALHPKHQALCREEIQGIMGNRDTIEWEDLGK
MTYSTMCIKESLRLFPPVPAVSRRLSKPVTFSDGRSLPEGSQVSLNIFGIHRNRDVWEDP
EVFDPLRFSPENSAHRHSHAFLPFSAGSRNCIGQQFAMNEMKVALALTLLRFELFPNASK
PPMLTQQLILKSRSGIHLHLKKIC
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctctcctggacaacatagccagaccttctgctgtcattctgcagctgtctgtg
gtgcttggtgtcatctttgtcctactgaaggtggtcagattctatcaggggaggaagaag
atcctcaaagccctggaagcatttcctggtcccccagcgcattggctctatggccacaac
catctgataactggtgacaaagtattgaatctattagtgtcactgggagaagaataccca
tatgcctttcccagatggtttggaccagtgctgccatctctagtagtccaccatcctgaa
tatgccaagactatacttggacgaggagatcccaagcctcctgtaccttatcagttctta
gttccatggattggcaaagggttgctggtcttgagtggaaccaaatggtttcagcatcgg
aagttgctcactccagcgtttcactatgatgtgctgaaatcttacgtgtccctgatgtca
gactcagtcaaagtgatgttggataaatgggagaagaagaagtcagtagagctcttcgaa
gacgtcagcctgatggcgctggacagcatcatgaaatgcgccttcagctacaacgccaac
tgccagactcagagcaactcagacacttacatcaaagccgttttcgacctgggctacctc
ataaacaagagaatacagaatttctcctaccaagatgccttctatgacctgactcacagc
agccgggagtttcaggatgcctgcaggcgggcccatgcccacacagataaagtaatacaa
gaaagaaagatattgctctccaatgacaaggagctagacaagatccggaagaagagacac
ctggattttctggacattcttctttgtaccaaggatgagaatggagttggcctgtctgat
gaggacctgcgtgctgaggtggacacattcatgtttgaggggcacgacaccacagccagc
gggatctcatggctcctgtactgcatggcattgcaccccaagcaccaggcactgtgcagg
gaggagatccaggggatcatggggaaccgggataccattgagtgggaggacctggggaag
atgacatacagcaccatgtgcatcaaggagagcttgcgcctgttcccacccgtccctgca
gtgtcccgaaggctctctaaacctgttacgttttctgatgggcgcagcttacctgaaggc
tcccaggtttcgttgaacatatttggtatccacaggaaccgggatgtatgggaagatccc
gaggtatttgatcccctgaggttttctcctgagaactcagcacacaggcattcacatgca
ttcctgcctttctctgctggatccaggaactgcattgggcagcagtttgctatgaacgag
atgaaggtggctctggcactgaccctgctccgcttcgagctgttccccaatgcctccaag
cctcctatgctgacacagcagctcatcctcaagtccagaagcggtatccacctgcatctg
aaaaagatttgctga

DBGET integrated database retrieval system