KEGG   Gallus gallus (chicken): 424618Help
Entry
424618            CDS       T01006                                 

Gene name
CYP4B1
Definition
cytochrome P450, family 4, subfamily B, polypeptide 1
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
8
AA seq 504 aa AA seqDB search
MVSLLDNIARPSAVILQLSVVLGVIFVLLKVVRFYQGRKKILKALEAFPGPPAHWLYGHN
HLITGDKVLNLLVSLGEEYPYAFPRWFGPVLPSLVVHHPEYAKTILGRGDPKPPVPYQFL
VPWIGKGLLVLSGTKWFQHRKLLTPAFHYDVLKSYVSLMSDSVKVMLDKWEKKKSVELFE
DVSLMALDSIMKCAFSYNANCQTQSNSDTYIKAVFDLGYLINKRIQNFSYQDAFYDLTHS
SREFQDACRRAHAHTDKVIQERKILLSNDKELDKIRKKRHLDFLDILLCTKDENGVGLSD
EDLRAEVDTFMFEGHDTTASGISWLLYCMALHPKHQALCREEIQGIMGNRDTIEWEDLGK
MTYSTMCIKESLRLFPPVPAVSRRLSKPVTFSDGRSLPEGSQVSLNIFGIHRNRDVWEDP
EVFDPLRFSPENSAHRHSHAFLPFSAGSRNCIGQQFAMNEMKVALALTLLRFELFPNASK
PPMLTQQLILKSRSGIHLHLKKIC
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctctcctggacaacatagccagaccttctgctgtcattctgcagctgtctgtg
gtgcttggtgtcatctttgtcctactgaaggtggtcagattctatcaggggaggaagaag
atcctcaaagccctggaagcatttcctggtcccccagcgcattggctctatggccacaac
catctgataactggtgacaaagtattgaatctattagtgtcactgggagaagaataccca
tatgcctttcccagatggtttggaccagtgctgccatctctagtagtccaccatcctgaa
tatgccaagactatacttggacgaggagatcccaagcctcctgtaccttatcagttctta
gttccatggattggcaaagggttgctggtcttgagtggaaccaaatggtttcagcatcgg
aagttgctcactccagcgtttcactatgatgtgctgaaatcttacgtgtccctgatgtca
gactcagtcaaagtgatgttggataaatgggagaagaagaagtcagtagagctcttcgaa
gacgtcagcctgatggcgctggacagcatcatgaaatgcgccttcagctacaacgccaac
tgccagactcagagcaactcagacacttacatcaaagccgttttcgacctgggctacctc
ataaacaagagaatacagaatttctcctaccaagatgccttctatgacctgactcacagc
agccgggagtttcaggatgcctgcaggcgggcccatgcccacacagataaagtaatacaa
gaaagaaagatattgctctccaatgacaaggagctagacaagatccggaagaagagacac
ctggattttctggacattcttctttgtaccaaggatgagaatggagttggcctgtctgat
gaggacctgcgtgctgaggtggacacattcatgtttgaggggcacgacaccacagccagc
gggatctcatggctcctgtactgcatggcattgcaccccaagcaccaggcactgtgcagg
gaggagatccaggggatcatggggaaccgggataccattgagtgggaggacctggggaag
atgacatacagcaccatgtgcatcaaggagagcttgcgcctgttcccacccgtccctgca
gtgtcccgaaggctctctaaacctgttacgttttctgatgggcgcagcttacctgaaggc
tcccaggtttcgttgaacatatttggtatccacaggaaccgggatgtatgggaagatccc
gaggtatttgatcccctgaggttttctcctgagaactcagcacacaggcattcacatgca
ttcctgcctttctctgctggatccaggaactgcattgggcagcagtttgctatgaacgag
atgaaggtggctctggcactgaccctgctccgcttcgagctgttccccaatgcctccaag
cctcctatgctgacacagcagctcatcctcaagtccagaagcggtatccacctgcatctg
aaaaagatttgctga

DBGET integrated database retrieval system