KEGG   Gallus gallus (chicken): 424643Help
Entry
424643            CDS       T01006                                 

Gene name
GPX7
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gga00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gga00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 210 aa AA seqDB search
MLDPEGSVEHKPSSSFPKVFLIPLAMLLAITALLLLAFSATQQKETDFYTFKVVNIRGKL
VSLEKYRGSVSLVVNVASECGFTDSHYKALQQLQKDLGPYHFNVLAFPCNQFGQQEPDTN
KEIESFARKTYGASFPMFSKVAVSGAGAIPAFKYLIDSTGEEPTWNFWKYLVDPNGKVVK
AWDSTVSVEEIRPHVTELVRKIILKKKDEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctagatcctgagggcagtgtggagcacaagccttcctcttccttccctaaagttttt
ctcattcctctagccatgctccttgcaattacagcactcctgctcttagcattttccgct
actcagcagaaagagactgatttttacacttttaaagttgtaaacatcaggggcaaacta
gtatctctggagaaatacaggggctcggtgtcgttagttgtcaacgttgcaagtgagtgt
gggtttacagatagtcactacaaggccttacaacagttacagaaagatcttggcccatat
catttcaatgtgctggcattcccatgcaatcagtttgggcagcaagaaccagacaccaac
aaagaaatagagagttttgcacgaaagacttacggtgcctcctttcctatgttcagcaaa
gttgcggtcagtggagctggtgcaattcctgccttcaagtacttaattgattctactgga
gaagaaccaacctggaacttctggaaatacttagtagaccccaatgggaaagtagtaaag
gcctgggactctactgtctctgttgaagaaataagacctcatgttacagaacttgtaagg
aaaatcatcctgaagaaaaaagatgaactgtga

DBGET integrated database retrieval system