KEGG   Gallus gallus (chicken): 424665Help
Entry
424665            CDS       T01006                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
8
AA seq 2660 aa AA seqDB search
MESEEEQHMTTLLCMGFSDAAAIRKALRLAKNDINEAVALLTNERPGLHYGGYEPMESGQ
GPPPGHGSPAGGQGSPDGDGGGGGGSGGFDPPPGYPEMVENEKNDENGNCSGEGIEFPTT
NLYELESRVLTDHWSIPYKREESLGKCLIASTYLARLGLSDSDENCKRFMDRCMPEAFKK
LLTSSAVHKWGTEIHEGIYNMLMLLVDLVAERVKQDPIPVGLLGVLTMAFNPDNEYHFKN
RMKVCQRNWAEVFGEGNMHAVSPISTFQKEPHGWLVDLVNRFAELGGFSAIQSKLNSEDI
ELGAISALVQPFGVCAEYLNSSVVQPMLDPVIHKMIKYVQNVEEKDLKDKRLVSIPELLS
GIKLLCMRFQPDLVTAVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIEDSTVSKSVKNA
IDTDRLLNWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKIWRIQSGQS
STVIENIHTIIAAAAVKFSSDQLNHLFVLIQKSWETESDRVRQKLLSLIGRIGREARVET
TTGKVLEVLWELAHLPTLPCSLIQQALEEHLTILSDAYAVKEAIKRSYIIKCIEDIKRKM
KPPRKAMSSSNNEVGSFVGSLSKCSLNSLCFLSEGSLQHQSDTSYLLTQPLVVLKILFFF
CYSCLNNISGGYFGINSDSKMSSQHNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSII
QDLKKNFEIVKLVTGSLISCHRLAASVAGPGGLVGATLVDGRYTYREYLEAHLKFLAFFL
QEATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKL
ESYEITMNGFSLFKTFFENVNLCDHRLKRQGTQLSVEKLELIGMDFIWKIAMESPDEEIA
NEAIQLIINYSYINLTPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKM
LTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDLYSVPRTILPHGASFHGHL
LTLNVTYESTKDTFTIEAHSNETVGSIRWKIAKMLNSPVDNIQIFANDSLLTVNKDQKLL
HQLGFSDEQVLTVKTSGSGTPSGSSADSSTSSSNSSSVFSSSYAMEQEKSLPGVVMALVC
NVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSESSSQSSK
SPSLSSKHQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDEMARNCAKS
FCENFLRAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDF
IKDGVEALSSRPFRNVSRQASRQMSICGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQ
TMEVNDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKENNTLFPAGIRNRLSSSGSNCSSG
SEGEPTALHAGICVRQQSVSTKDALIAGEALSLLVTCLQLRSQQLGSFYNLPCVADFIID
ILLGSPSAEIRRVACDQLYTLSQTDTSTHPDVQKPNQFLLSVILGAQLPLWSPTSIMRGI
NQRLLSQCTEYFDLRCQLLDDLTSSEMEQLKISPAAMLEDEITWLENFEPNRTAECETSE
ADNILLAGHLRLIKTLLSLCGAEKEMVGSSLIKPLLDDFLFRASRIILNSHSPAGSAAIS
QQDFHPKCSTADSRLAAYEVLVMLADSSPSNLQLITKELLSMHHQCDPALTKEFDYLPPV
DSRSISGFVGLKNGGATCYMNAVFQQLYMQPGLPEALLSIDDDTDNPDDNVFYQVQSLFG
HLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKIGRDQIFKN
TFQGIFSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNAYYCE
KCKEKRTTVKRTCIKVLPNLLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYTVSGM
ARQDSSSEVGDNGRNVDQGGGGSPRKKVAPTENYELVGVIVHSGQAHAGHYYSFIKDRRG
CGKGKWYKFNDTVVEEFELTDETLEYECFGGEYRPKVYDQSNPYPDVRRRYWNAYMLFYQ
RVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNSDRLSILTKLVR
KGEKKGLFVEKMPVRIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKVKHPYYPC
MAKVSLQLAVQFLFQTYLRTKKKLRADTEEWIATIDALLSKSIDACQWLVEYFVGPEGRE
LVKTFLLECSVREVRVAVATILEKTLDSALFYQEKLKSLHQLLEVLLALLDKDVPENCKN
CAQYFLLFNNFVQKQGIRASSLLLRHSALRHMINFLLGPNRQSNQNRRWSSAQAREFGYL
HNTVALLVLHSDVSSQRNVAPGLFKQRPPLSITTSGPLLTLYEEVEALLFLSEGKPYLIE
VMYALRELTGSLSVLIEMVVYCCFCNEHFSFTVLHFIKTQLETAPPHELKNIFQLLHEIL
VIEDPLQVERIKFAFETENGLIGKFQFPRCPTAKDYFKENSHHWSWAVQWLQKKMSEHYW
APQSNVSNETSTAKTFQRTISAQDTLAYATALLNEKDQSGSSNGSESSPANENGDRHLQQ
GSESPMMIGETKNDLDDVDP
NT seq 7983 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgaggaggagcagcacatgaccacgctgctctgcatgggcttctcggacgcc
gccgccatccgcaaggccctgcgcctggccaagaacgacatcaacgaggccgtggcgctg
ctcaccaacgagcggcccggcctgcactacggcggctacgagcccatggagagcgggcag
ggcccgccgcccggacacggctcccccgccggcgggcagggctcccccgacggggacggc
ggcggcgggggcggcagtggaggcttcgaccctccgcccgggtaccccgaaatggtggag
aatgagaaaaatgatgaaaatgggaattgctctggagaaggcattgagtttccaacaacc
aacttgtatgagctagagagcagagttctaacagatcactggtccataccctataagcgg
gaggaatctctaggcaagtgcctgattgcatccacatatctagcaagactgggtctttct
gattctgatgagaattgcaagagatttatggacagatgcatgcctgaagcatttaaaaag
ttgttgacatccagtgctgttcacaaatggggaactgaaatccacgaaggaatatacaac
atgcttatgctgctggtagacctggttgcagaaagagtaaagcaagatcctattcctgtg
ggcctgcttggtgtgcttacaatggcatttaaccctgacaatgagtatcatttcaagaat
cgaatgaaggtatgccagagaaactgggcagaagtctttggagaggggaatatgcacgct
gtgtcacccatatccacgtttcagaaggaacctcatgggtggctggtggatctggtaaac
aggtttgcagagttgggtggattttcagcaattcagtccaaactcaattcagaagatatt
gagcttggggcaatctctgcattagttcaaccatttggagtttgtgccgagtatcttaac
tcttctgtagtacagcccatgctggatccagtcatacataaaatgattaaatatgtgcag
aatgtagaagagaaggacttgaaagacaagagactagtcagtatccctgagctcctgtct
ggtattaaactgctgtgtatgcgctttcaacctgatttagtaactgcagtagatgattta
cggctggacattctgctgcgcatgttaaaatcgcctcacttcagtgcaaaaatgaattcc
ctcaaagaagtaaccaaattaatagaagacagtactgtgtccaagtcagtgaagaatgca
atagatacagaccgattactaaactggctggtagaaaattctgtcctgtcaattgctcta
gaaggtaatatagaccaagcacagtactgtgatcgtataaagggaattattgaactgctg
ggcagtaaactgtctttagatgaactcactaaaatttggagaattcagtcaggacaatct
tccactgtgattgaaaacatacataccattattgctgcagccgctgtgaagtttagctct
gatcagctcaatcatttatttgttctaattcaaaagagctgggaaacagagagtgataga
gtgcggcagaagctgttgagcctgatagggcgcattggtcgagaagcacgggtggagaca
accactggaaaggttctggaggtgctttgggagctggctcatcttccaacattaccatgc
agtcttattcagcaggcattggaggaacacctgacaatcctcagtgatgcctatgcagtg
aaagaggcaatcaaaagaagctacatcatcaaatgcattgaggatattaagaggaaaatg
aagcctcccagaaaagcgatgagcagttctaacaatgaggtaggatcctttgtaggatct
ctttcaaaatgcagcctaaatagcctttgcttcctatcagagggctccttgcagcaccaa
tcagacacttcttatcttttaacccaacccttggtagtacttaagattctttttttcttc
tgttactcttgccttaacaatatctcgggggggtactttgggattaatagtgatagcaaa
atgtcatcccagcacaataatcctcagtttgtttgggtggtaccagcattgcgtcaactc
catgaaatcacacgttcttttataaaacaaacttaccaaaagcaagacaagagcattatt
caagacctaaagaaaaactttgaaatagtgaagttggtgacaggaagcttaatatcgtgc
caccgtttggctgcatctgtggcaggtcctggaggacttgttggagcaacgttggtggat
ggccgatacacttaccgggagtatttggaagcgcatctaaaatttttggcattttttctg
caagaagccaccctttatttgggctggaatcgtgccaaagagatctgggagtgcctcgta
actggccaggacgtttgtgagttagatcgagagatgtgctttgagtggtttaccaaagga
cagcatgatctagagagtgatgtacagcaacagctcttcaaagagaaaattcttaaactg
gaatcatatgaaattactatgaatggttttagtttatttaagactttctttgaaaatgtg
aacctgtgtgaccatcgactgaagaggcaaggaactcagctgagtgtagaaaaactggaa
ttaataggaatggatttcatttggaagattgcaatggagtcacctgatgaagaaattgcc
aatgaagctattcaactgataataaattacagctatattaacctcactcctagactgaaa
aaggattcagtatcactgcacaagaaattcattgctgattgctacacacgattggaggca
gccagttcagcactcggtggtccaacgttaacacatgctgttacaagagctacaaaaatg
cttacagcaactgctatgcctacagtagcaacatcagttcaatctccttataggtctact
aaacttgtaataattgagagactgctgttactggcagaacgttatgtaataacaatagag
gacctttactctgtgccccgaactattctacctcacggtgcctcttttcatggacatctt
ttaactcttaatgttacatacgaatctaccaaagataccttcaccatagaggctcatagc
aatgaaactgtagggagcatcaggtggaagatagcaaagatgctgaattctcctgtggat
aacatacagatatttgccaatgacagcctgctaacagtaaataaagatcagaaattactc
caccaattgggcttctctgatgaacaagtccttacagtgaaaacatcaggcagtgggaca
ccttcagggagctcggctgattcctcaaccagttccagcaacagcagtagtgtatttagt
tcatcctatgcaatggaacaggagaaatccctccctggagtagtcatggctctcgtgtgt
aatgtgtttgatatgctttaccagcttgccaatctagaggagccaagaataacgctgcga
gtgagaaaacttctgctcttaattcccactgacccagctattcaggaggcacttgatcag
cttgattccctgggaaggaagaaaacgctgctatcagaatcaagttctcagtcttcgaaa
tccccatccttgtcttcaaaacaccaacatcagccaagtgctagttcaatactggaaagt
ctgttcaggtcttttgctccaggcatgtctaccttcagagtactctacaatttagaggta
ctgagctccaagctgatgccaactgcagatgatgaaatggcaagaaactgtgctaagtca
ttctgtgaaaattttctcagagcaggaggcttgagtttggtggtgaatgtcatgcagaga
gattccatcccatcagaagtagactatgaaaccagacagggggtctattccatctgcctg
caacttgcaaggttcttgcttgttggccagacgatgcctaccttactggatgaagatttt
attaaagatggagtagaagcattgtcctcacgccccttccgtaatgtcagccgacaagca
agtaggcagatgtccatttgtggaacacctgagaagtcatcctaccgacagctctctgtg
tctgatagatcgtccattagggtagaagaaatcataccagcagcaagggttgccatacaa
actatggaggtgaatgatttcacttccacagtggcttgtttcatgcgactctcttgggct
gctgctgcaggacgactggacctcgtaggaagtagtcagccaataaaagaaaacaacact
ttatttcctgcagggattcgaaacagacttagcagctcaggaagtaattgcagctcagga
agtgaaggagagccaaccgcgctgcatgctggtatctgtgtgagacagcagtccgtgtct
accaaagatgctctgattgctggagaagccttgtctctattagtaacctgccttcagcta
cgcagtcagcagctaggatctttttacaatttgccttgtgttgctgatttcattattgac
atactgcttggatcaccaagcgctgagattcgtcgtgttgcctgtgaccagttgtacacc
cttagtcaaactgacacgtcaactcatccagatgtacaaaagccaaaccagtttctcctg
agcgttatccttggtgcccagctgcctctttggtcaccaaccagcatcatgagaggaatt
aaccagagacttttgtcccagtgtactgaatattttgatctgagatgtcagttattggat
gacctcacttcatcagaaatggaacagctaaagataagcccagctgccatgttagaagat
gagattacctggctagaaaactttgaacccaaccgcacagctgagtgtgagaccagtgaa
gctgataacatcctattagcaggacacttgaggctcatcaagactctcctttcactctgt
ggggcagagaaggaaatggttggttcatctttgattaagccattgttggatgatttcctc
ttccgagcatccaggattattctgaacagccattctccagcaggcagtgctgcaatcagt
cagcaagactttcatccaaagtgcagtacagcagatagccgattagctgcctatgaagtg
ttagtaatgctggctgatagctcaccttccaatcttcagcttattacgaaagagctgctt
tctatgcatcaccaatgcgacccagctcttaccaaggagtttgattatcttccaccagtg
gatagtcgctccatttcaggatttgtgggactgaagaatggtggtgctacttgttatatg
aatgctgtctttcagcagctgtatatgcagcctggtctcccagaggctctgctttccatt
gatgatgataccgacaatccagatgacaacgtgttctatcaagttcagtctctttttggt
cacttgatggaaagcaaactacagtattatgtacctgagaacttttggaagatcttcaag
atgtggaataaggaactttatgttcgagagcaacaggatgcttatgagttctttaccagt
cttatagatcaaatggatgagtacctcaagaaaataggaagagaccaaatatttaagaat
acttttcaaggtatcttttctgatcagaagatctgcaaggactgtcctcacagatatgag
cgggaggaagccttcatggctctcaacttaggtgtgacttcgtgtcaaagtttggaaata
tcattggatcaatttgtcaggggagaagttctggaaggaagtaatgcatactactgtgaa
aaatgcaaagaaaagagaactacagtgaagcgcacatgcattaaggtcttaccaaacctt
ttggtgatacacctgatgagatttggctttgactgggagagcggacgttctattaaatat
gatgaacaaataaggttcccctggatgctgaacatggagccttacactgtgtcagggatg
gctcgccaggactcgtcctcagaagtgggggacaatggtagaaacgtggatcaaggaggt
ggagggtccccaaggaagaaagttgcacctacagagaactatgagcttgttggtgtgatt
gttcacagtggccaggctcatgcagggcattactactcctttataaaggacaggagggga
tgtggaaagggaaagtggtataaatttaatgacactgttgttgaagaatttgagttaact
gatgaaacgttggaatatgaatgttttggtggagagtatagacctaaagtctatgatcaa
tctaacccttaccctgatgtgcgtcgacggtactggaatgcctacatgctgttttatcag
agagtgtctgatcagaactctccggtcttaccaaagaaaagtcgagtgagtgtcgtgcgt
caggaagctgaggacctctcactatctgctccatcttcaccagaaatttcaccccagtca
tcaccacgaccccacagacccaacagtgatcgcctgtccatcttaactaaactggtccga
aaaggtgaaaaaaagggactttttgtagagaagatgcctgtgcggatatatcagatggtg
agagatgaaaacctgaaatttatgaagaacagagatgtatacagtagtgactacttcagt
tttgttctgtcgctagcttcactaaatgctactaaggtaaaacatccttattatccgtgt
atggcaaaggtgagcttacagttggcagtccagttcctcttccaaacttatctccgaacc
aagaagaaactcagggctgatacagaagagtggattgcaaccatagatgcactgctctcc
aaaagtattgatgcttgtcagtggttagttgaatattttgttggaccagagggccgggag
cttgtaaagactttcctcctggaatgcagtgtaagagaggtgcgagttgctgtagctact
attcttgaaaaaaccctcgacagtgccttgttttatcaagagaagttgaaaagtctacat
cagttactggaggtgctacttgctttactggataaggatgttcctgaaaactgcaaaaac
tgtgctcagtacttcttactattcaacaattttgtgcagaagcagggtataagggctagc
agtcttcttctcagacattctgctttgaggcacatgatcaactttctccttggtcccaac
cgtcagagtaatcagaaccgcagatggagttcagcacaagcacgtgagtttggatatctt
cacaatactgtcgcgctacttgttttgcactctgatgtctcttcacaaagaaatgttgct
cctggtctctttaagcaacgtccacctttaagcatcactacttcaggtccgcttttgaca
ctctatgaagaagtggaagccttgttattcttgtctgagggaaaaccttacttaatagag
gtgatgtatgcattacgagagctaactggatctctgtcagttctaattgagatggtggtg
tactgctgcttttgtaatgagcacttttcctttactgtgctacacttcatcaagactcag
ctggaaactgctccacctcatgaattgaaaaacatattccagttactccatgagatactg
gtcatcgaagaccccttacaagtagagcgtatcaaatttgcctttgaaacagaaaatgga
ttaataggcaagtttcaatttccaaggtgccctactgcaaaagattatttcaaggagaat
tcccaccactggagttgggctgtgcagtggctacagaaaaagatgtctgaacattattgg
gcacctcagagtaacgtttccaatgaaacatcaactgcaaaaaccttccagcgcactatt
tcagcacaggacacgctggcctatgccacagccttgctgaatgaaaaagatcagtctgga
agcagtaatgggtccgaaagtagtccagccaatgagaacggagacagacatctacagcag
ggctcagagtctcctatgatgattggtgagactaaaaatgaccttgatgatgttgacccg
taa

DBGET integrated database retrieval system