KEGG   Gallus gallus (chicken): 424676Help
Entry
424676            CDS       T01006                                 

Definition
cytochrome P450 2J2-like
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    424676
   00591 Linoleic acid metabolism
    424676
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     424676
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP2 family
   424676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
8
AA seq 494 aa AA seqDB search
MLRFLWDSISLQMLFVFLLVFLLVSDYMKRRKPKDFPPSPFSFPFLGNVQFMFAKDPVVA
TQKLTEKLGDIFSMQAGSQSFVIVNGLPLIKEALVTQGENFMDRPEIPLDTDIFSKLGLI
SSSGHLWKQQRRFTLTTLRNFGLGKRSLEERIQEECRFLTEAFRDEQGNPFNPHLKINNA
VSNIICSVTFGNRFEYHDENFQTLLRLMDETVTLHEKIMSQLYNAFPSIVKYLPGSHQTI
FKNWRLMKDFVNEKISKHKEDLNPSESRDFIDSYLQEMAKVSNPSGSEFHEENLVACALD
LLFAGTETTSTTIRWALLFMAVYPEIQAHVQAEIDAVIGQARQPALEDRNNMPYTNAVIH
EVQRKGNIIPFNVPRQAVKDTVLAGFRVPKGTILIPNLSSVMYDKKEWETPHSFNPGHFL
KDGQFWKREAFMPFSIGKRACLGELLARAELFLFFTSLLQKFTFQAPPDTILDFKFTMGI
TLAPRPYKICAVPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttcctctgggacagcatctccctgcagatgctcttcgtcttcctccttgtc
ttcctgcttgtctcggactacatgaagaggagaaagccgaaggacttccccccaagtcct
ttttccttccctttcctgggaaatgtgcagtttatgtttgcgaaagaccccgtggttgca
acacagaagcttactgaaaaacttggggatatcttcagcatgcaagcaggcagccagtca
tttgtgattgtaaatggacttccactgatcaaggaagcccttgtgacccagggagagaac
ttcatggatcgccctgaaattcctcttgacacagatatcttcagcaaactggggctgatc
tcttccagtgggcacctgtggaagcagcagagaaggttcactttgaccacccttcgaaac
tttggcctggggaagaggagcctggaggagcggatacaggaggagtgccgattcctcacg
gaagcgttcagggatgagcagggaaatcctttcaaccctcaccttaaaatcaacaatgct
gtttcaaacatcatctgctccgtcacctttggcaaccggtttgaataccatgatgagaac
ttccaaaccttgctgcggctgatggatgagactgttaccctccatgagaaaataatgagc
cagctgtacaatgctttcccctccatagtgaagtacctccctggatcccaccaaaccata
tttaaaaactggaggctcatgaaagattttgtgaacgagaagatcagcaaacataaggaa
gatctgaacccctcagagagccgggacttcatcgacagctacctgcaggagatggccaag
gtcagcaatcccagtggcagtgaattccatgaggaaaacctggtggcatgtgctcttgac
ctactgtttgctgggactgagaccacttccacaaccatccgctgggccctgctgtttatg
gccgtatatccggaaattcaagcccatgtacaagcggagatcgatgctgtcattgggcag
gcccggcagccagccctagaggacaggaacaacatgccctacaccaatgccgtcatacat
gaagtgcagaggaaaggcaacatcatccctttcaatgtgccgagacaggcggtgaaggac
acagtcttggctggtttccgggtgcccaagggtactattttgatcccaaatctgtcctct
gtgatgtatgacaagaaggagtgggaaacccctcacagttttaatcctgggcatttcctg
aaggacggtcagttctggaaaagggaggcttttatgccgttttctatagggaagcgcgcc
tgcctgggtgagctgctggcccgcgccgagctcttcctcttcttcacgtctctgctccag
aaattcaccttccaggctcccccggacaccatccttgacttcaaattcaccatgggcatc
accttggccccccggccctacaagatctgcgcagtgccgcggtag

DBGET integrated database retrieval system